StarFunc result for job id Q9Y222

User Input

>input (760 residues)
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSED
DQSIDDSTPCISVVALPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEIS
PLGNEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDA
TEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVGKYTPEEIEKLKELRI
KHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEEEKRLAEVVHELTSTEPGDIV
TQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILRIAELDVADEN
DINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPVLIKGLKQLHENQKNNPTLL
ENKSGSGVPNSNTNSSVQHVQIRVARLEDNTAISSSPMAALQIPVQITHVSSADSPATVD
SETITLNSGTLQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTLTASPTVTLTAAAPAS
PEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDF
PEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL
KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPL
TTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CE22	0.527	0.526	1.470E-100	761	0.953	0.951	Q8CE22.pdb.gz	DMTF1_MOUSE Cyclin-D-binding Myb-like transcription factor 1 OS=Mus musculus OX=10090 GN=Dmtf1 PE=1 SV=2
2	AFDB:E7EPA0	0.371	0.408	8.245E-85	690	0.907	0.999	E7EPA0.pdb.gz	E7EPA0_HUMAN Cyclin D binding myb like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
3	AFDB:P34127	0.190	0.125	1.015E-7	1230	0.129	0.080	P34127.pdb.gz	MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum OX=44689 GN=mybA PE=4 SV=2
4	AFDB:F4JV48	0.177	0.139	6.633E-7	995	0.130	0.099	F4JV48.pdb.gz	F4JV48_ARATH Homeodomain-like protein OS=Arabidopsis thaliana OX=3702 GN=PC-MYB1 PE=1 SV=1
5	AFDB:Q94FL9	0.178	0.144	8.401E-6	961	0.132	0.104	Q94FL9.pdb.gz	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
6	AFDB:Q8I239	0.051	0.032	7.642E-5	1710	0.128	0.057	Q8I239.pdb.gz	PI51N_PLAF7 Phosphatidylinositol 4-phosphate 5-kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PIP5K PE=1 SV=1
7	AFDB:Q9BIW6	0.045	0.046	2.305E-4	749	0.136	0.138	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
8	AFDB:O16117	0.073	0.068	5.574E-4	844	0.130	0.117	O16117.pdb.gz	O16117_DROME Shaven, isoform A OS=Drosophila melanogaster OX=7227 GN=sv PE=2 SV=1
9	AFDB:F1QVS5	0.193	0.104	6.224E-4	1561	0.168	0.082	F1QVS5.pdb.gz	F1QVS5_DANRE Small nuclear RNA-activating complex, polypeptide 4 OS=Danio rerio OX=7955 GN=fi18h02 PE=4 SV=3
10	AFDB:A0A2K7P776	0.052	0.049	9.160E-4	867	0.112	0.098	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
11	PDB:6id0L	0.103	0.161	7.842E-3	475	0.058	0.093	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:6qdvO	0.117	0.192	9.779E-3	441	0.045	0.077	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
13	PDB:3jb9W	0.116	0.197	1.289E-2	426	0.054	0.096	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:6j6gc	0.114	0.192	2.641E-2	436	0.063	0.110	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	PDB:5yzgL	0.115	0.201	5.122E-2	419	0.059	0.107	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:5gmkc	0.113	0.191	5.719E-2	436	0.049	0.085	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
17	PDB:6iczL	0.116	0.188	6.387E-2	454	0.062	0.104	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:5gm6c	0.116	0.203	9.399E-2	415	0.050	0.092	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5z56L	0.113	0.235	9.399E-2	342	0.043	0.096	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:5lj5O	0.106	0.260	1.109E-1	283	0.043	0.117	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EPA0	0.0	962	690	0.709	0.781	E7EPA0_HUMAN Cyclin D binding myb like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
2	Q8CE22	0.0	1480	761	0.953	0.951	DMTF1_MOUSE Cyclin-D-binding Myb-like transcription factor 1 OS=Mus musculus OX=10090 GN=Dmtf1 PE=1 SV=2
3	Q9Y222	0.0	1552	760	1.000	1.000	DMTF1_HUMAN Cyclin-D-binding Myb-like transcription factor 1 OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
4	J3QKU5	1.10e-115	348	178	0.229	0.978	J3QKU5_HUMAN Cyclin D binding myb like transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
5	H7C388	8.00e-92	286	176	0.188	0.812	H7C388_HUMAN Cyclin D binding myb like transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=DMTF1 PE=1 SV=1
6	Q62187	1.23e-26	119	859	0.107	0.094	TTF1_MOUSE Transcription termination factor 1 OS=Mus musculus OX=10090 GN=Ttf1 PE=1 SV=2
7	Q15361	1.01e-23	109	905	0.111	0.093	TTF1_HUMAN Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3
8	J9VW97	4.57e-14	78.2	625	0.107	0.130	LIV4_CRYNH DNA-binding protein LIV4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LIV4 PE=4 SV=2
9	Q9UUI6	7.90e-14	77.0	466	0.074	0.120	RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rtf1 PE=1 SV=2
10	Q12457	1.52e-11	70.1	570	0.075	0.100	NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSI1 PE=1 SV=1
11	Q9P6H9	8.67e-11	67.4	504	0.054	0.081	REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=reb1 PE=1 SV=1
12	F1QP25	8.34e-09	61.2	590	0.055	0.071	F1QP25_DANRE Transcriptional activator Myb isoform 2 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
13	F1QP24	9.75e-09	61.2	641	0.055	0.066	F1QP24_DANRE Transcriptional activator Myb isoform 1 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
14	E9PLN0	2.46e-08	59.7	611	0.054	0.067	E9PLN0_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
15	Q708E1	2.93e-08	59.7	612	0.054	0.067	Q708E1_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=c-myb PE=1 SV=1
16	A0A0G2JV86	3.73e-08	59.3	614	0.058	0.072	A0A0G2JV86_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
17	P01103	3.76e-08	59.3	641	0.062	0.073	MYB_CHICK Transcriptional activator Myb OS=Gallus gallus OX=9031 GN=MYB PE=1 SV=1
18	A0A8I5ZUL7	3.84e-08	59.3	635	0.058	0.069	A0A8I5ZUL7_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
19	F8W8G5	3.88e-08	59.3	726	0.054	0.056	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
20	P10242	3.89e-08	59.3	640	0.054	0.064	MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20588 DMTF1_N	5.4e-25	99.2	Cyclin-D-binding Myb-like transcription factor 1 N-terminal
2	PF17884 DUF5591	13	17.0	Domain of unknown function (DUF5591)
3	PF00249 Myb_DNA-binding	1.6e-28	110.0	Myb-like DNA-binding domain
4	PF13837 Myb_DNA-bind_4	3.2e+02	13.1	Myb/SANT-like DNA-binding domain
5	PF13921 Myb_DNA-bind_6	1.9e-13	61.7	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378193

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261254	0.787	G1/S-specific cyclin-D2
2	9606.ENSP00000448073	0.743	Pre-mRNA-processing factor 40 homolog B
3	9606.ENSP00000300060	0.726	Aminopeptidase N
4	9606.ENSP00000337732	0.725	RUN domain containing 3B
5	9606.ENSP00000269305	0.713	Cellular tumor antigen p53
6	9606.ENSP00000398083	0.666	Transmembrane protein 243
7	9606.ENSP00000358242	0.638	Arginine/serine-rich protein PNISR
8	9606.ENSP00000281928	0.622	Mediator of RNA polymerase II transcription subunit 13-like
9	9606.ENSP00000440190	0.614	Tudor domain-containing protein 3
10	9606.ENSP00000401115	0.600	SS18-like protein 2
11	9606.ENSP00000259229	0.591	Coiled-coil domain-containing protein 115
12	9606.ENSP00000353793	0.587	WD repeat and HMG-box DNA-binding protein 1
13	9606.ENSP00000257904	0.568	Cyclin-dependent kinase 4
14	9606.ENSP00000425092	0.564	Luc7-like protein 3
15	9606.ENSP00000335321	0.561	Splicing factor 3B subunit 1
16	9606.ENSP00000424417	0.550	Pleiotropic regulator 1
17	9606.ENSP00000300145	0.549	Mitochondrial inner membrane protease ATP23 homolog
18	9606.ENSP00000478255	0.526	Multidrug resistance protein 1
19	9606.ENSP00000399457	0.524	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
20	9606.ENSP00000229238	0.523	Mitochondrial ribosomal protein L51

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0001216	0.995	DNA-binding transcription activator activity
GO:0000981	0.995	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.995	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.994	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0080090	0.975	regulation of primary metabolic process
GO:0019219	0.971	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.968	regulation of biosynthetic process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0010468	0.950	regulation of gene expression
GO:0051252	0.948	regulation of RNA metabolic process
GO:0010556	0.946	regulation of macromolecule biosynthetic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:1903506	0.942	regulation of nucleic acid-templated transcription
GO:0048518	0.929	positive regulation of biological process
GO:0006355	0.929	regulation of DNA-templated transcription
GO:0048522	0.912	positive regulation of cellular process
GO:0010604	0.905	positive regulation of macromolecule metabolic process
GO:0051173	0.896	positive regulation of nitrogen compound metabolic process
GO:0031325	0.895	positive regulation of cellular metabolic process
GO:0009891	0.871	positive regulation of biosynthetic process
GO:0045944	0.853	positive regulation of transcription by RNA polymerase II
GO:0009987	0.528	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.464	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]