StarFunc result for job id Q9Y223

User Input

>input (722 residues)
MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRM
IEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALA
TSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILL
AGCPSYDKLLSAKNKDYMSIIRMWLGDDVKSKDYIVALQHPVTTDIKHSIKMFELTLDAL
ISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGN
SSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKI
YGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLR
VAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRILGVGISTGGRVNP
REGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTL
ITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYASGMALQREA
KKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTM
NPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRR
IY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4II12	0.553	0.534	0.000	748	0.810	0.782	A0A0R4II12.pdb.gz
2	AFDB:O35826	0.858	0.858	0.000	722	0.986	0.986	O35826.pdb.gz	GLCNE_RAT Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Rattus norvegicus OX=10116 GN=Gne PE=1 SV=1
3	AFDB:Q5ZXH8	0.506	0.954	1.162E-33	377	0.166	0.318	Q5ZXH8.pdb.gz	NEUCH_LEGPH UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpg0753 PE=1 SV=1
4	AFDB:Q0P8T0	0.485	0.893	5.494E-30	384	0.144	0.271	Q0P8T0.pdb.gz	NEUCH_CAMJE GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=legG PE=1 SV=1
5	AFDB:B1VZT1	0.376	0.823	1.984E-25	313	0.137	0.316	B1VZT1.pdb.gz	B1VZT1_STRGG Glucokinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) OX=455632 GN=glkA PE=1 SV=1
6	PDB:3vgkB	0.384	0.846	2.450E-25	312	0.126	0.292	3vgkB.pdb.gz	Substrate recognition mechanism and substrate-dependent conformational changes of an ROK family glucokinase from Streptomyces griseus
7	AFDB:P0A4E1	0.373	0.806	3.079E-25	317	0.143	0.325	P0A4E1.pdb.gz	GLK_STRCO Glucokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=glkA PE=1 SV=1
8	AFDB:P54495	0.386	0.823	3.253E-25	321	0.116	0.262	P54495.pdb.gz	GLK_BACSU Glucokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=glcK PE=1 SV=2
9	AFDB:P0AF20	0.398	0.688	5.074E-24	406	0.094	0.167	P0AF20.pdb.gz	NAGC_ECOLI N-acetylglucosamine repressor OS=Escherichia coli (strain K12) OX=83333 GN=nagC PE=2 SV=1
10	PDB:1z6rA	0.383	0.690	6.266E-24	382	0.097	0.183	1z6rA.pdb.gz	The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
11	AFDB:P50456	0.389	0.666	8.789E-24	406	0.094	0.167	P50456.pdb.gz	MLC_ECOLI Protein mlc OS=Escherichia coli (strain K12) OX=83333 GN=mlc PE=1 SV=2
12	PDB:1f6dA	0.395	0.698	3.880E-21	376	0.116	0.223	1f6dA.pdb.gz	The structure of UDP-N-acetylglucosamine 2-epimerase reveals homology to phosphoglycosyl transferases.
13	AFDB:P27828	0.415	0.752	1.174E-20	376	0.112	0.215	P27828.pdb.gz	WECB_ECOLI UDP-N-acetylglucosamine 2-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=wecB PE=1 SV=2
14	PDB:7p7wBBB	0.365	0.819	5.422E-20	306	0.104	0.245	7p7wBBB.pdb.gz	Structure and function of N-acetylglucosamine kinase illuminates the catalytic mechanism of ROK kinases
15	PDB:2aa4A	0.354	0.847	7.540E-20	289	0.105	0.263	2aa4A.pdb.gz	Crystal Structure of Escherichia Coli Putative N-Acetylmannosamine Kinase
16	PDB:3htvA	0.304	0.700	9.118E-15	279	0.083	0.215	3htvA.pdb.gz
17	PDB:4qs7A	0.313	0.471	1.694E-11	455	0.104	0.165	4qs7A.pdb.gz	Biochemical and structural study of Arabidopsis hexokinase 1
18	PDB:3b8aX	0.313	0.455	2.110E-11	470	0.098	0.151	3b8aX.pdb.gz	Crystal structure of yeast hexokinase PI in complex with glucose: A classical "induced fit" example revised.
19	PDB:1ig8A	0.292	0.418	5.995E-11	469	0.093	0.143	1ig8A.pdb.gz
20	PDB:6jj7A	0.292	0.428	2.008E-10	465	0.096	0.148	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35826	0.0	1468	722	0.986	0.986	GLCNE_RAT Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Rattus norvegicus OX=10116 GN=Gne PE=1 SV=1
2	Q6P3K2	0.0	1173	725	0.813	0.810	Q6P3K2_DANRE Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Danio rerio OX=7955 GN=zgc:77657 PE=1 SV=1
3	Q91WG8	0.0	1469	722	0.988	0.988	GLCNE_MOUSE Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Mus musculus OX=10090 GN=Gne PE=1 SV=1
4	Q9Y223	0.0	1484	722	1.000	1.000	GLCNE_HUMAN Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Homo sapiens OX=9606 GN=GNE PE=1 SV=1
5	Q5ZXH8	7.32e-52	186	377	0.173	0.332	NEUCH_LEGPH UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpg0753 PE=1 SV=1
6	Q0P8T0	1.39e-40	155	384	0.144	0.271	NEUCH_CAMJE GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=legG PE=1 SV=1
7	Q6DNI4	5.13e-28	117	317	0.145	0.331	Q6DNI4_STRC0 Glucokinase OS=Streptomyces peucetius subsp. caesius OX=55158 GN=glk PE=3 SV=1
8	P0A4E1	1.81e-27	115	317	0.133	0.303	GLK_STRCO Glucokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=glkA PE=1 SV=1
9	B1VZT1	1.55e-26	112	313	0.126	0.291	B1VZT1_STRGG Glucokinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) OX=455632 GN=glkA PE=1 SV=1
10	P50456	1.92e-17	87.4	406	0.091	0.163	MLC_ECOLI Protein mlc OS=Escherichia coli (strain K12) OX=83333 GN=mlc PE=1 SV=2
11	P54495	3.36e-17	85.5	321	0.105	0.237	GLK_BACSU Glucokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=glcK PE=1 SV=2
12	P75959	2.00e-16	82.8	303	0.098	0.234	NAGK_ECOLI N-acetyl-D-glucosamine kinase OS=Escherichia coli (strain K12) OX=83333 GN=nagK PE=1 SV=1
13	P0AF20	2.85e-13	74.7	406	0.096	0.170	NAGC_ECOLI N-acetylglucosamine repressor OS=Escherichia coli (strain K12) OX=83333 GN=nagC PE=2 SV=1
14	P23917	4.94e-13	72.8	302	0.098	0.235	MAK_ECOLI Fructokinase OS=Escherichia coli (strain K12) OX=83333 GN=mak PE=1 SV=2
15	G0FS68	3.97e-11	67.0	303	0.105	0.251	RIFN_AMYMS Kanosamine kinase OS=Amycolatopsis mediterranei (strain S699) OX=713604 GN=rifN PE=1 SV=1
16	P27828	6.50e-11	67.0	376	0.125	0.239	WECB_ECOLI UDP-N-acetylglucosamine 2-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=wecB PE=1 SV=2
17	A0A0H2UR62	9.66e-09	59.7	295	0.111	0.271	A0A0H2UR62_STRPN Fructokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=scrK PE=1 SV=1
18	P45425	2.11e-07	55.5	291	0.105	0.261	NANK_ECOLI N-acetylmannosamine kinase OS=Escherichia coli (strain K12) OX=83333 GN=nanK PE=1 SV=2
19	A0KYQ6	4.80e-06	51.6	308	0.100	0.234	AGAK_SHESA N-acetylgalactosamine kinase AgaK OS=Shewanella sp. (strain ANA-3) OX=94122 GN=agaK PE=1 SV=1
20	P32718	6.08e-06	51.2	309	0.072	0.168	ALSK_ECOLI D-allose kinase OS=Escherichia coli (strain K12) OX=83333 GN=alsK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07085 DRTGG	6.3	18.0	DRTGG domain
2	PF02350 Epimerase_2	4e-62	221.7	UDP-N-acetylglucosamine 2-epimerase
3	PF00370 FGGY_N	8.1	17.5	FGGY family of carbohydrate kinases, N-terminal domain
4	PF00349 Hexokinase_1	2.5	19.4	Hexokinase
5	PF00480 ROK	5.2e-51	185.5	ROK family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004676

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021883	0.994	N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)
2	61853.ENSNLEP00000023869	0.994	N-acetylneuraminic acid synthase
3	61853.ENSNLEP00000023445	0.983	UDP-N-acetylglucosamine pyrophosphorylase 1
4	61853.ENSNLEP00000010877	0.948	UDP-N-acetylglucosamine pyrophosphorylase 1 like 1
5	61853.ENSNLEP00000011290	0.947	Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
6	61853.ENSNLEP00000017285	0.914	4-hydroxy-2-oxoglutarate aldolase 1
7	61853.ENSNLEP00000011473	0.833	N-acetylglucosamine-6-phosphate deacetylase
8	61853.ENSNLEP00000010400	0.788	Transaldolase 1
9	61853.ENSNLEP00000010558	0.733	Belongs to the NAD(P)-dependent epimerase/dehydratase family
10	61853.ENSNLEP00000001438	0.727	Actinin, alpha 1
11	61853.ENSNLEP00000019049	0.724	N-acetylneuraminic acid phosphatase
12	61853.ENSNLEP00000009992	0.722	Protein-glucosylgalactosylhydroxylysine glucosidase
13	61853.ENSNLEP00000014192	0.720	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
14	61853.ENSNLEP00000010048	0.719	Phosphoglucomutase 5
15	61853.ENSNLEP00000018349	0.719	Uncharacterized protein
16	61853.ENSNLEP00000017377	0.709	Glucose-6-phosphate dehydrogenase
17	61853.ENSNLEP00000015712	0.707	Solute carrier family 35 (CMP-sialic acid transporter), member A1
18	61853.ENSNLEP00000022445	0.707	Pseudouridine 5'-phosphatase
19	61853.ENSNLEP00000019029	0.704	Uncharacterized protein
20	61853.ENSNLEP00000019825	0.704	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0019200	1.000	carbohydrate kinase activity
GO:0008761	1.000	UDP-N-acetylglucosamine 2-epimerase activity
GO:0005515	0.999	protein binding
GO:0009384	0.462	N-acylmannosamine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044281	0.983	small molecule metabolic process
GO:0006040	0.981	amino sugar metabolic process
GO:0043603	0.852	amide metabolic process
GO:0006082	0.804	organic acid metabolic process
GO:1901564	0.742	organonitrogen compound metabolic process
GO:0043436	0.641	oxoacid metabolic process
GO:0019752	0.569	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.494	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:17213	1.000	UDP-N-acetyl-alpha-D-glucosamine = UDP-N-acetyl-alpha-D-mannosamine
EC:5.1.3.14	1.000	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing).
RHEA:23832	0.462	an N-acyl-D-mannosamine + ATP = ADP + an N-acyl-D-mannosamine 6-phosphate + H(+)
EC:2.7.1.60	0.462	N-acylmannosamine kinase.

[back to server]