StarFunc result for job id Q9Y224

User Input

>input (244 residues)
MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFF
EKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPL
INLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLP
VALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLG
KVGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q549M8	0.473	0.473	8.289E-34	244	1.000	1.000	Q549M8.pdb.gz	Q549M8_HUMAN RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=C14orf166 PE=2 SV=1
2	AFDB:Q6QI16	0.407	0.344	9.250E-30	296	0.955	0.787	Q6QI16.pdb.gz	Q6QI16_RAT RNA transcription, translation and transport factor protein OS=Rattus norvegicus OX=10116 GN=Rtraf PE=1 SV=1
3	AFDB:Q17RN3	0.304	0.224	1.461E-1	349	0.160	0.112	Q17RN3.pdb.gz	FA98C_HUMAN Protein FAM98C OS=Homo sapiens OX=9606 GN=FAM98C PE=1 SV=1
4	AFDB:Q59YF0	0.156	0.130	9.925E-1	295	0.160	0.132	Q59YF0.pdb.gz	SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSO2 PE=3 SV=1
5	PDB:6uw9A	0.154	0.083	1.223	582	0.152	0.064	6uw9A.pdb.gz
6	AFDB:O94730	0.132	0.077	1.426	449	0.107	0.058	O94730.pdb.gz	CHMP7_SCHPO Charged multivesicular body protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cmp7 PE=3 SV=1
7	AFDB:Q9PVD3	0.111	0.068	1.666	536	0.148	0.067	Q9PVD3.pdb.gz	Q9PVD3_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1ra PE=2 SV=1
8	AFDB:O94532	0.168	0.041	1.754	1461	0.160	0.027	O94532.pdb.gz	FOR3_SCHPO Formin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=for3 PE=1 SV=1
9	PDB:6k15J	0.130	0.133	1.758	235	0.135	0.140	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
10	PDB:7l08AV	0.147	0.110	1.758	367	0.172	0.114	7l08AV.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
11	AFDB:Q96LB0	0.147	0.114	2.158	322	0.131	0.099	Q96LB0.pdb.gz	MRGX3_HUMAN Mas-related G-protein coupled receptor member X3 OS=Homo sapiens OX=9606 GN=MRGPRX3 PE=1 SV=2
12	PDB:6yafB	0.129	0.071	2.162	579	0.176	0.074	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
13	AFDB:Q99680	0.167	0.103	2.273	433	0.107	0.060	Q99680.pdb.gz	GPR22_HUMAN G-protein coupled receptor 22 OS=Homo sapiens OX=9606 GN=GPR22 PE=2 SV=2
14	AFDB:Q8AW57	0.107	0.091	2.393	300	0.123	0.100	Q8AW57.pdb.gz
15	PDB:6hivCO	0.100	0.077	2.398	361	0.098	0.066	6hivCO.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:6v1qA	0.096	0.059	2.950	538	0.131	0.059	6v1qA.pdb.gz	Resting state structure of the hyperdepolarization activated two-pore channel 3.
17	PDB:3vprA	0.114	0.139	3.107	189	0.070	0.090	3vprA.pdb.gz
18	PDB:7sqkE	0.131	0.060	3.446	610	0.160	0.064	7sqkE.pdb.gz
19	PDB:2f6lA	0.141	0.186	3.629	166	0.070	0.102	2f6lA.pdb.gz
20	PDB:6tejB	0.142	0.070	3.629	585	0.111	0.046	6tejB.pdb.gz	The ABC exporter IrtAB imports and reduces mycobacterial siderophores.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q549M8	0.0	500	244	1.000	1.000	Q549M8_HUMAN RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=C14orf166 PE=2 SV=1
2	Q9Y224	0.0	500	244	1.000	1.000	RTRAF_HUMAN RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1
3	F7EMB2	8.53e-177	487	244	0.971	0.971	F7EMB2_RAT RNA transcription, translation and transport factor protein OS=Rattus norvegicus OX=10116 GN=Rtraf PE=3 SV=1
4	Q6QI16	1.10e-164	458	296	0.971	0.801	Q6QI16_RAT RNA transcription, translation and transport factor protein OS=Rattus norvegicus OX=10116 GN=Rtraf PE=1 SV=1
5	A0A8I6AA36	1.63e-156	436	238	0.898	0.920	A0A8I6AA36_RAT RNA transcription, translation and transport factor protein OS=Rattus norvegicus OX=10116 GN=Rtraf PE=1 SV=1
6	A0A8I6GBA2	1.46e-155	432	221	0.881	0.973	A0A8I6GBA2_RAT RNA transcription, translation and transport factor protein OS=Rattus norvegicus OX=10116 GN=Rtraf PE=1 SV=1
7	G3V4C6	6.78e-131	369	193	0.725	0.917	G3V4C6_HUMAN RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1
8	P32558	0.27	35.0	1035	0.135	0.032	SPT16_YEAST FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT16 PE=1 SV=1
9	Q9Y4P1	0.62	33.5	393	0.119	0.074	ATG4B_HUMAN Cysteine protease ATG4B OS=Homo sapiens OX=9606 GN=ATG4B PE=1 SV=2
10	F1R8W3	1.6	32.3	488	0.061	0.031	F1R8W3_DANRE Desmin a OS=Danio rerio OX=7955 GN=cb290 PE=1 SV=1
11	F1R8W4	1.6	32.3	473	0.061	0.032	F1R8W4_DANRE Desmin a OS=Danio rerio OX=7955 GN=cb290 PE=1 SV=1
12	Q9W792	1.8	32.3	556	0.119	0.052	Q9W792_DANRE T-complex protein 1 subunit alpha OS=Danio rerio OX=7955 GN=CHUNP6875 PE=1 SV=1
13	P46614	4.7	30.8	504	0.102	0.050	KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC19 PE=1 SV=3
14	P12613	5.3	30.8	557	0.102	0.045	TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster OX=7227 GN=CCT1 PE=2 SV=2
15	Q05AI8	6.3	30.4	474	0.057	0.030	Q05AI8_DANRE Desmin OS=Danio rerio OX=7955 GN=zgc:154009 PE=2 SV=1
16	B2ZDY6	6.4	30.4	556	0.115	0.050	B2ZDY6_RABIT T-complex protein 1 subunit alpha OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
17	Q32L40	6.4	30.4	556	0.115	0.050	TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus OX=9913 GN=TCP1 PE=1 SV=1
18	P17987	6.5	30.4	556	0.115	0.050	TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1
19	P28480	6.6	30.4	556	0.115	0.050	TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Tcp1 PE=1 SV=1
20	P41988	6.9	30.4	549	0.102	0.046	TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cct-1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10312 Cactin_mid	10	17.3	Conserved mid region of cactin
2	PF10036 RLL	5.8e-88	306.6	RNA transcription, translation and transport factor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015086

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017623	0.997	DEAD (Asp-Glu-Ala-Asp) box helicase 1
2	61853.ENSNLEP00000006103	0.994	tRNA-splicing ligase RtcB homolog
3	61853.ENSNLEP00000013855	0.992	Family with sequence similarity 98, member B
4	61853.ENSNLEP00000012890	0.983	Chromosome 2 open reading frame 49
5	61853.ENSNLEP00000019438	0.966	Family with sequence similarity 98, member A
6	61853.ENSNLEP00000003389	0.955	Zinc finger and BTB domain containing 8 opposite strand
7	61853.ENSNLEP00000005688	0.918	tRNA-splicing endonuclease subunit Sen2
8	61853.ENSNLEP00000007672	0.875	tRNA-splicing endonuclease subunit Sen34
9	61853.ENSNLEP00000001251	0.870	Uncharacterized protein
10	61853.ENSNLEP00000002530	0.865	Uncharacterized protein
11	61853.ENSNLEP00000020481	0.865	Family with sequence similarity 98, member C
12	61853.ENSNLEP00000021898	0.865	annotation not available
13	61853.ENSNLEP00000015936	0.769	Proteasome (prosome, macropain) subunit, alpha type, 3
14	61853.ENSNLEP00000014918	0.710	Ninein (GSK3B interacting protein)
15	61853.ENSNLEP00000005359	0.663	Peptidylprolyl isomerase
16	61853.ENSNLEP00000018149	0.663	T-box 19
17	61853.ENSNLEP00000011057	0.637	RAB6A GEF complex partner 1
18	61853.ENSNLEP00000015144	0.616	Thioredoxin domain containing 16
19	61853.ENSNLEP00000009810	0.585	Coiled-coil domain containing 22
20	61853.ENSNLEP00000020728	0.568	tRNA nucleus export receptor which facilitates tRNA translocation across the nuclear pore complex.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.617	organic cyclic compound binding
GO:1901363	0.594	heterocyclic compound binding
GO:0003676	0.558	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016070	0.995	RNA metabolic process
GO:0006403	0.992	RNA localization
GO:0010468	0.992	regulation of gene expression
GO:0006396	0.991	RNA processing
GO:0009892	0.990	negative regulation of metabolic process
GO:0015931	0.989	nucleobase-containing compound transport
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0065009	0.985	regulation of molecular function
GO:0009893	0.985	positive regulation of metabolic process
GO:0048523	0.984	negative regulation of cellular process
GO:0010605	0.983	negative regulation of macromolecule metabolic process
GO:0009889	0.982	regulation of biosynthetic process
GO:0051236	0.980	establishment of RNA localization
GO:0051173	0.980	positive regulation of nitrogen compound metabolic process
GO:0050657	0.980	nucleic acid transport
GO:0051174	0.979	regulation of phosphorus metabolic process
GO:0051246	0.978	regulation of protein metabolic process
GO:0051172	0.972	negative regulation of nitrogen compound metabolic process
GO:0050658	0.969	RNA transport
GO:0006399	0.968	tRNA metabolic process
GO:0031324	0.967	negative regulation of cellular metabolic process
GO:0051338	0.965	regulation of transferase activity
GO:0019220	0.960	regulation of phosphate metabolic process
GO:0043086	0.959	negative regulation of catalytic activity
GO:0031399	0.959	regulation of protein modification process
GO:0010556	0.954	regulation of macromolecule biosynthetic process
GO:0051252	0.950	regulation of RNA metabolic process
GO:0051348	0.949	negative regulation of transferase activity
GO:0045936	0.949	negative regulation of phosphate metabolic process
GO:0042325	0.945	regulation of phosphorylation
GO:0034470	0.941	ncRNA processing
GO:0051248	0.935	negative regulation of protein metabolic process
GO:0042326	0.931	negative regulation of phosphorylation
GO:0033673	0.921	negative regulation of kinase activity
GO:0031400	0.920	negative regulation of protein modification process
GO:0048522	0.918	positive regulation of cellular process
GO:0031326	0.909	regulation of cellular biosynthetic process
GO:0001933	0.875	negative regulation of protein phosphorylation
GO:0045859	0.865	regulation of protein kinase activity
GO:0006469	0.849	negative regulation of protein kinase activity
GO:0010604	0.846	positive regulation of macromolecule metabolic process
GO:0008380	0.835	RNA splicing
GO:0031325	0.790	positive regulation of cellular metabolic process
GO:0006355	0.678	regulation of DNA-templated transcription
GO:0008033	0.669	tRNA processing
GO:0045935	0.660	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.586	regulation of transcription by RNA polymerase II
GO:0031328	0.542	positive regulation of cellular biosynthetic process
GO:0010557	0.539	positive regulation of macromolecule biosynthetic process
GO:0051254	0.500	positive regulation of RNA metabolic process
GO:0045893	0.471	positive regulation of DNA-templated transcription
GO:0045944	0.379	positive regulation of transcription by RNA polymerase II
GO:0071840	0.305	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0005737	0.966	cytoplasm
GO:0043232	0.908	intracellular non-membrane-bounded organelle
GO:1902494	0.833	catalytic complex
GO:0140535	0.715	intracellular protein-containing complex
GO:0005829	0.492	cytosol
GO:0005815	0.462	microtubule organizing center
GO:0005813	0.386	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]