StarFunc result for job id Q9Y227

User Input

>input (616 residues)
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGR
LTRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDI
RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTA
GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI
EDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN
LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNRLLGKQTGLTP
DMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASH
ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPL
RDIQQEAFRASHTHWRGVSFVYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAA
LWMEEGLPAQNAPGTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y227	1.000	1.000	0.000	616	1.000	1.000	Q9Y227.pdb.gz	ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens OX=9606 GN=ENTPD4 PE=1 SV=1
2	AFDB:Q3TCT4	0.806	0.819	5.725E-81	606	0.602	0.612	Q3TCT4.pdb.gz	ENTP7_MOUSE Ectonucleoside triphosphate diphosphohydrolase 7 OS=Mus musculus OX=10090 GN=Entpd7 PE=1 SV=1
3	AFDB:Q21815	0.627	0.695	2.041E-50	552	0.294	0.328	Q21815.pdb.gz	MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans OX=6239 GN=mig-23 PE=1 SV=2
4	AFDB:Q18411	0.605	0.682	9.008E-44	543	0.266	0.302	Q18411.pdb.gz	NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans OX=6239 GN=ntp-1 PE=1 SV=2
5	AFDB:Q9USP2	0.596	0.638	7.184E-40	572	0.258	0.278	Q9USP2.pdb.gz	YND1_SCHPO Golgi apyrase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ynd1 PE=3 SV=1
6	AFDB:P40009	0.586	0.574	3.886E-39	630	0.260	0.254	P40009.pdb.gz	YND1_YEAST Golgi apyrase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YND1 PE=1 SV=1
7	AFDB:O75355	0.543	0.625	6.642E-35	529	0.216	0.251	O75355.pdb.gz	ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens OX=9606 GN=ENTPD3 PE=1 SV=2
8	AFDB:P49961	0.567	0.674	2.084E-34	510	0.208	0.251	P49961.pdb.gz	ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1
9	AFDB:Q8BFW6	0.541	0.622	8.129E-34	529	0.208	0.242	Q8BFW6.pdb.gz	ENTP3_MOUSE Ectonucleoside triphosphate diphosphohydrolase 3 OS=Mus musculus OX=10090 GN=Entpd3 PE=1 SV=1
10	AFDB:P97687	0.550	0.654	1.840E-33	511	0.200	0.241	P97687.pdb.gz	ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Entpd1 PE=1 SV=1
11	PDB:6pbzA	0.324	0.397	1.521E-8	485	0.094	0.120	6pbzA.pdb.gz
12	PDB:1u6zB	0.340	0.405	4.214E-7	500	0.089	0.110	1u6zB.pdb.gz
13	PDB:4dchA	0.194	0.250	5.078E-5	434	0.096	0.136	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
14	PDB:5ljwA	0.185	0.293	8.753E-5	331	0.086	0.160	5ljwA.pdb.gz	X-ray and cryo-EM structures of monomeric and filamentous actin-like protein MamK reveal changes associated with polymerization.
15	PDB:3idhA	0.236	0.299	1.088E-4	453	0.097	0.132	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
16	PDB:6jj7A	0.241	0.300	1.776E-4	465	0.093	0.123	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex
17	PDB:4ehtA	0.209	0.402	1.876E-4	268	0.089	0.205	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
18	PDB:6pbzD	0.224	0.283	2.900E-4	454	0.075	0.101	6pbzD.pdb.gz
19	PDB:1jcfA	0.156	0.254	4.020E-4	336	0.068	0.125	1jcfA.pdb.gz
20	PDB:7t1iB	0.224	0.364	6.215E-4	314	0.091	0.178	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TCT4	0.0	779	606	0.610	0.620	ENTP7_MOUSE Ectonucleoside triphosphate diphosphohydrolase 7 OS=Mus musculus OX=10090 GN=Entpd7 PE=1 SV=1
2	Q9NQZ7	0.0	795	604	0.617	0.629	ENTP7_HUMAN Ectonucleoside triphosphate diphosphohydrolase 7 OS=Homo sapiens OX=9606 GN=ENTPD7 PE=2 SV=1
3	Q9Y227	0.0	1291	616	1.000	1.000	ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens OX=9606 GN=ENTPD4 PE=1 SV=1
4	Q21815	3.46e-103	325	552	0.284	0.317	MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans OX=6239 GN=mig-23 PE=1 SV=2
5	Q18411	3.41e-80	265	543	0.255	0.289	NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans OX=6239 GN=ntp-1 PE=1 SV=2
6	P40009	3.24e-69	238	630	0.242	0.237	YND1_YEAST Golgi apyrase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YND1 PE=1 SV=1
7	Q9USP2	2.50e-62	218	572	0.245	0.264	YND1_SCHPO Golgi apyrase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ynd1 PE=3 SV=1
8	P55772	2.94e-44	167	510	0.222	0.269	ENTP1_MOUSE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus OX=10090 GN=Entpd1 PE=1 SV=1
9	P97687	1.05e-42	162	511	0.213	0.256	ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Entpd1 PE=1 SV=1
10	P49961	3.66e-42	161	510	0.226	0.273	ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1
11	O75355	2.61e-40	156	529	0.211	0.246	ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens OX=9606 GN=ENTPD3 PE=1 SV=2
12	A0A1D5PS27	5.14e-40	155	496	0.234	0.290	A0A1D5PS27_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=3 SV=1
13	P79784	9.84e-40	154	495	0.237	0.295	ENTP2_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=1 SV=2
14	O55026	2.88e-39	152	495	0.224	0.279	ENTP2_MOUSE Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus OX=10090 GN=Entpd2 PE=1 SV=2
15	Q9Y5L3	1.23e-37	148	495	0.211	0.263	ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens OX=9606 GN=ENTPD2 PE=1 SV=1
16	O35795	1.84e-37	147	495	0.221	0.275	ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Entpd2 PE=1 SV=1
17	O80612	4.14e-37	147	555	0.219	0.243	APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana OX=3702 GN=APY6 PE=2 SV=2
18	Q6NQA8	1.52e-35	142	488	0.195	0.246	APY5_ARATH Probable apyrase 5 OS=Arabidopsis thaliana OX=3702 GN=APY5 PE=2 SV=1
19	Q8K0L2	3.09e-35	141	497	0.219	0.272	ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus OX=10090 GN=Entpd8 PE=1 SV=3
20	Q8TGH6	3.39e-35	142	599	0.208	0.214	GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01150 GDA1_CD39	1.4e-103	358.5	GDA1/CD39 (nucleoside phosphatase) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351520

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333019	0.953	Adenylosuccinate synthetase isozyme 1
2	9606.ENSP00000369456	0.930	Inosine triphosphate pyrophosphatase
3	9606.ENSP00000406261	0.929	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
4	9606.ENSP00000236959	0.926	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000355493	0.919	Adenylosuccinate synthetase isozyme 2
6	9606.ENSP00000354238	0.913	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
7	9606.ENSP00000320171	0.907	Pyruvate kinase PKM
8	9606.ENSP00000232607	0.906	Uridine 5'-monophosphate synthase
9	9606.ENSP00000419851	0.905	GMP synthase [glutamine-hydrolyzing]
10	9606.ENSP00000259727	0.904	GMP reductase 1
11	9606.ENSP00000321584	0.904	Inosine-5'-monophosphate dehydrogenase 2
12	9606.ENSP00000345096	0.904	Inosine-5'-monophosphate dehydrogenase 1
13	9606.ENSP00000298556	0.902	Hypoxanthine-guanine phosphoribosyltransferase
14	9606.ENSP00000339933	0.902	Pyruvate kinase PKLR
15	9606.ENSP00000362481	0.900	Uracil phosphoribosyltransferase homolog
16	9606.ENSP00000365840	0.900	Ectonucleoside triphosphate diphosphohydrolase 6
17	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
18	9606.ENSP00000377814	0.900	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
19	9606.ENSP00000335246	0.899	Ectonucleoside triphosphate diphosphohydrolase 5
20	9606.ENSP00000352904	0.830	Cytosolic 5'-nucleotidase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017111	1.000	ribonucleoside triphosphate phosphatase activity
GO:0017110	1.000	nucleoside diphosphate phosphatase activity
GO:0004382	0.879	GDP phosphatase activity
GO:0045134	0.878	UDP phosphatase activity
GO:0005488	0.860	binding
GO:0005515	0.815	protein binding
GO:0043273	0.460	CTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0009259	0.988	ribonucleotide metabolic process
GO:0006163	0.975	purine nucleotide metabolic process
GO:0009150	0.974	purine ribonucleotide metabolic process
GO:0009166	0.970	nucleotide catabolic process
GO:1901136	0.957	carbohydrate derivative catabolic process
GO:0072527	0.957	pyrimidine-containing compound metabolic process
GO:0006220	0.900	pyrimidine nucleotide metabolic process
GO:0009261	0.897	ribonucleotide catabolic process
GO:1901565	0.873	organonitrogen compound catabolic process
GO:0009218	0.860	pyrimidine ribonucleotide metabolic process
GO:0006195	0.808	purine nucleotide catabolic process
GO:0009154	0.769	purine ribonucleotide catabolic process
GO:0072529	0.742	pyrimidine-containing compound catabolic process
GO:0009141	0.719	nucleoside triphosphate metabolic process
GO:0009199	0.669	ribonucleoside triphosphate metabolic process
GO:0034656	0.640	nucleobase-containing small molecule catabolic process
GO:0009132	0.610	nucleoside diphosphate metabolic process
GO:0009185	0.580	ribonucleoside diphosphate metabolic process
GO:0009179	0.457	purine ribonucleoside diphosphate metabolic process
GO:0065007	0.408	biological regulation
GO:0050789	0.404	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005794	0.978	Golgi apparatus
GO:0031090	0.976	organelle membrane
GO:0098588	0.829	bounding membrane of organelle
GO:0031982	0.633	vesicle
GO:0005773	0.598	vacuole
GO:0005829	0.540	cytosol
GO:0005776	0.486	autophagosome
GO:0000139	0.440	Golgi membrane
GO:0005774	0.383	vacuolar membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36799	1.000	a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H(+) + phosphate
RHEA:23680	1.000	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.6	1.000	nucleoside diphosphate phosphatase.
EC:3.6.1.15	1.000	nucleoside-triphosphate phosphatase.
RHEA:22156	0.879	GDP + H2O = GMP + H(+) + phosphate
EC:3.6.1.42	0.879	guanosine-diphosphatase.
RHEA:64876	0.878	H2O + UDP = H(+) + phosphate + UMP
RHEA:29387	0.460	CTP + H2O = CDP + H(+) + phosphate

[back to server]