StarFunc result for job id Q9Y228

User Input

>input (551 residues)
MISPDPRPSPGLARWAESYEAKCERRQEIRESRRCRPNVTTCRQVGKTLRIQQREQLQRA
RLQQFFRRRNLELEEKGKAQHPQAREQGPSRRPGQVTVLKEPLSCARRISSPREQVTGTS
SEVFPAQHPPPSGICRDLSDHLSSQAGGLPPQDTPIKKPPKHHRGTQTKAEGPTIKNDAS
QQTNYGVAVLDKEIIQLSDYLKEALQRELVLKQKMVILQDLLSTLIQASDSSWKGQLNED
KLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQ
LQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKLQGADSRDLQM
NQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLL
QNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAK
EKECRELHSELDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPVLMVVIAAALA
VFLANKDNLMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y228	1.000	1.000	6.990E-83	551	1.000	1.000	Q9Y228.pdb.gz	T3JAM_HUMAN TRAF3-interacting JNK-activating modulator OS=Homo sapiens OX=9606 GN=TRAF3IP3 PE=1 SV=2
2	AFDB:Q8C0G2	0.513	0.547	2.303E-51	513	0.695	0.747	Q8C0G2.pdb.gz	T3JAM_MOUSE TRAF3-interacting JNK-activating modulator OS=Mus musculus OX=10090 GN=Traf3ip3 PE=1 SV=2
3	AFDB:Q96KN7	0.125	0.056	3.736E-6	1286	0.167	0.072	Q96KN7.pdb.gz	RPGR1_HUMAN X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2
4	AFDB:Q9EPQ2	0.126	0.055	1.425E-5	1331	0.147	0.061	Q9EPQ2.pdb.gz	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
5	AFDB:Q386I1	0.124	0.081	4.682E-5	932	0.165	0.098	Q386I1.pdb.gz	Q386I1_TRYB2 Centromere protein J C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0810 PE=3 SV=1
6	AFDB:F1P0K1	0.213	0.124	6.790E-5	997	0.211	0.116	F1P0K1.pdb.gz
7	AFDB:Q9C099	0.151	0.084	9.142E-5	1032	0.152	0.081	Q9C099.pdb.gz	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
8	AFDB:A0A2C9C2L6	0.105	0.096	2.589E-4	624	0.152	0.135	A0A2C9C2L6.pdb.gz	A0A2C9C2L6_CAEEL Intraflagellar transport protein 74 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-74 PE=4 SV=1
9	AFDB:Q0D2I5	0.145	0.143	2.789E-4	559	0.129	0.127	Q0D2I5.pdb.gz	IFFO1_HUMAN Non-homologous end joining factor IFFO1 OS=Homo sapiens OX=9606 GN=IFFO1 PE=1 SV=2
10	AFDB:O94986	0.130	0.051	3.755E-4	1710	0.183	0.059	O94986.pdb.gz	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
11	PDB:7mqaNB	0.048	0.173	1.983	103	0.040	0.214	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:5lj5O	0.061	0.102	6.049	283	0.047	0.092	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:7w5a2	0.080	0.296	7.019	123	0.047	0.211	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:7qooK	0.107	0.218	9.450	253	0.044	0.095	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C0G2	0.0	643	513	0.704	0.756	T3JAM_MOUSE TRAF3-interacting JNK-activating modulator OS=Mus musculus OX=10090 GN=Traf3ip3 PE=1 SV=2
2	Q9Y228	0.0	1112	551	1.000	1.000	T3JAM_HUMAN TRAF3-interacting JNK-activating modulator OS=Homo sapiens OX=9606 GN=TRAF3IP3 PE=1 SV=2
3	Q3URD3	5.07e-28	121	845	0.132	0.086	SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus OX=10090 GN=Slmap PE=1 SV=2
4	Q14BN4	1.32e-27	120	828	0.131	0.087	SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1
5	Q9W5R5	8.15e-12	70.5	897	0.109	0.067	Q9W5R5_DROME LD47843p OS=Drosophila melanogaster OX=7227 GN=Slmap PE=1 SV=2
6	A6NC98	0.11	38.1	1476	0.080	0.030	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
7	Q9VKH9	0.14	37.7	1931	0.163	0.047	Q9VKH9_DROME CENP-ana, isoform A OS=Drosophila melanogaster OX=7227 GN=cana PE=3 SV=2
8	Q4QRL3	0.49	35.8	1481	0.083	0.031	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
9	Q9NCF9	0.97	35.0	1931	0.162	0.046	Q9NCF9_DROME Mitotic kinesin-like motor protein CENP-ana OS=Drosophila melanogaster OX=7227 GN=cana PE=2 SV=1
10	Q8RWD5	1.1	34.7	577	0.062	0.059	SCD2_ARATH Coiled-coil domain-containing protein SCD2 OS=Arabidopsis thaliana OX=3702 GN=SCD2 PE=1 SV=1
11	Q92805	1.3	34.3	767	0.080	0.057	GOGA1_HUMAN Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3
12	X2J5P0	1.3	34.7	1409	0.165	0.065	X2J5P0_DROME CENP-ana, isoform B OS=Drosophila melanogaster OX=7227 GN=cana PE=4 SV=1
13	Q8CB87	2.4	33.5	973	0.049	0.028	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
14	C8VIR1	3.0	33.1	1207	0.089	0.041	C8VIR1_EMENI Calmodulin-binding coil-coil protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03062 PE=4 SV=1
15	F6ZDS4	3.3	33.1	2431	0.142	0.032	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
16	P49025	3.8	33.1	2055	0.074	0.020	CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus OX=10090 GN=Cit PE=1 SV=3
17	Q8K3M6	5.1	32.3	957	0.089	0.051	ERC2_RAT ERC protein 2 OS=Rattus norvegicus OX=10116 GN=Erc2 PE=1 SV=1
18	P46864	5.3	32.3	745	0.085	0.063	KN14M_ARATH Kinesin-like protein KIN-14M OS=Arabidopsis thaliana OX=3702 GN=KIN14M PE=1 SV=1
19	Q5B3B1	6.7	32.0	738	0.051	0.038	NDC80_EMENI Probable kinetochore protein ndc80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ndc80 PE=3 SV=1
20	Q7Z6P3	6.7	32.0	1021	0.065	0.035	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02183 HALZ	15	17.2	Homeobox associated leucine zipper

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350071	0.996	Striatin-3
2	9606.ENSP00000229395	0.995	FGFR1 oncogene partner 2
3	9606.ENSP00000263918	0.995	Striatin
4	9606.ENSP00000315702	0.995	MOB-like protein phocein
5	9606.ENSP00000358541	0.995	Suppressor of IKBKE 1
6	9606.ENSP00000358810	0.995	Striatin-interacting protein 1
7	9606.ENSP00000249344	0.994	Striatin-interacting protein 2
8	9606.ENSP00000375777	0.994	Striatin-4
9	9606.ENSP00000377867	0.994	Serine/threonine-protein kinase 26
10	9606.ENSP00000376506	0.993	Programmed cell death protein 10
11	9606.ENSP00000418447	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
12	9606.ENSP00000311344	0.992	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
13	9606.ENSP00000365730	0.940	Serine/threonine-protein kinase 24
14	9606.ENSP00000324804	0.937	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
15	9606.ENSP00000325748	0.936	Serine/threonine-protein kinase 25
16	9606.ENSP00000454207	0.933	TNF receptor-associated factor 3
17	9606.ENSP00000280326	0.913	T-complex protein 1 subunit epsilon
18	9606.ENSP00000286788	0.913	T-complex protein 1 subunit theta
19	9606.ENSP00000295688	0.913	T-complex protein 1 subunit gamma
20	9606.ENSP00000317334	0.913	T-complex protein 1 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050896	0.994	response to stimulus
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0051716	0.963	cellular response to stimulus
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0044419	0.935	biological process involved in interspecies interaction between organisms
GO:0002376	0.900	immune system process
GO:0010468	0.854	regulation of gene expression
GO:0042221	0.850	response to chemical
GO:0050794	0.828	regulation of cellular process
GO:0006950	0.786	response to stress
GO:0065009	0.765	regulation of molecular function
GO:0051239	0.760	regulation of multicellular organismal process
GO:0010033	0.729	response to organic substance
GO:0009605	0.634	response to external stimulus
GO:0034097	0.591	response to cytokine
GO:0006952	0.571	defense response
GO:0006955	0.567	immune response
GO:0009607	0.559	response to biotic stimulus
GO:0051240	0.555	positive regulation of multicellular organismal process
GO:0051707	0.542	response to other organism
GO:0001817	0.535	regulation of cytokine production
GO:0010628	0.527	positive regulation of gene expression
GO:0070887	0.511	cellular response to chemical stimulus
GO:0009615	0.499	response to virus
GO:0071310	0.480	cellular response to organic substance
GO:0001819	0.480	positive regulation of cytokine production
GO:0098542	0.478	defense response to other organism
GO:0071345	0.473	cellular response to cytokine stimulus
GO:0045087	0.386	innate immune response
GO:0048522	0.365	positive regulation of cellular process
GO:0031323	0.358	regulation of cellular metabolic process
GO:0080090	0.338	regulation of primary metabolic process
GO:0051171	0.337	regulation of nitrogen compound metabolic process
GO:0051607	0.329	defense response to virus
GO:0043393	0.318	regulation of protein binding
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0005829	0.938	cytosol
GO:0071944	0.907	cell periphery
GO:0005634	0.752	nucleus
GO:0005886	0.669	plasma membrane
GO:0005856	0.311	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]