StarFunc result for job id Q9Y230

User Input

>input (463 residues)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4QQS4	0.955	0.955	3.333E-86	463	0.994	0.994	Q4QQS4.pdb.gz	Q4QQS4_RAT RuvB-like helicase OS=Rattus norvegicus OX=10116 GN=Ruvbl2 PE=1 SV=1
2	AFDB:P83571	0.952	0.952	1.255E-84	463	0.883	0.883	P83571.pdb.gz	RUVB2_DANRE RuvB-like 2 OS=Danio rerio OX=7955 GN=ruvbl2 PE=1 SV=1
3	AFDB:Q9FJW0	0.967	0.955	4.610E-79	469	0.741	0.731	Q9FJW0.pdb.gz	Q9FJW0_ARATH RuvB-like helicase OS=Arabidopsis thaliana OX=3702 GN=ISE4 PE=1 SV=1
4	AFDB:Q9V3K3	0.890	0.858	2.440E-77	481	0.758	0.730	Q9V3K3.pdb.gz	RUVB2_DROME RuvB-like helicase 2 OS=Drosophila melanogaster OX=7227 GN=rept PE=1 SV=1
5	AFDB:Q9M2X5	0.959	0.939	1.220E-75	473	0.691	0.677	Q9M2X5.pdb.gz	Q9M2X5_ARATH RuvB-like helicase OS=Arabidopsis thaliana OX=3702 GN=T16K5.180 PE=1 SV=1
6	AFDB:O94692	0.908	0.904	1.920E-75	465	0.683	0.680	O94692.pdb.gz	RUVB2_SCHPO RuvB-like helicase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rvb2 PE=1 SV=1
7	AFDB:Q8ID85	0.940	0.902	2.327E-74	483	0.663	0.636	Q8ID85.pdb.gz	Q8ID85_PLAF7 RuvB-like helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1362200 PE=3 SV=1
8	AFDB:Q583J3	0.910	0.890	4.862E-74	474	0.702	0.686	Q583J3.pdb.gz	Q583J3_TRYB2 RuvB-like helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.640 PE=3 SV=1
9	AFDB:G0RYC2	0.868	0.826	5.892E-73	488	0.661	0.627	G0RYC2.pdb.gz	G0RYC2_CHATD RuvB-like helicase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0006170 PE=1 SV=1
10	AFDB:Q12464	0.866	0.852	1.730E-72	471	0.663	0.652	Q12464.pdb.gz	RUVB2_YEAST RuvB-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RVB2 PE=1 SV=1
11	PDB:6htsD	0.754	0.798	1.412E-69	434	0.935	0.998	6htsD.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
12	PDB:5oafF	0.705	0.789	1.094E-60	407	0.873	0.993	5oafF.pdb.gz	Cryo-EM structures of the human INO80 chromatin-remodeling complex.
13	PDB:6gejY	0.686	0.709	5.788E-59	447	0.657	0.680	6gejY.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:6fhsE	0.827	0.865	9.109E-59	441	0.646	0.678	6fhsE.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
15	PDB:5fm7B	0.686	0.750	2.180E-57	422	0.618	0.678	5fm7B.pdb.gz	The Combination of X-Ray Crystallography and Cryo-Electron Microscopy Provides Insight Into the Overall Architecture of the Dodecameric Rvb1/Rvb2 Complex.
16	PDB:6gejT	0.650	0.675	3.081E-49	443	0.400	0.418	6gejT.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:6htsE	0.659	0.685	1.346E-48	443	0.415	0.433	6htsE.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
18	PDB:2c9oA	0.685	0.791	3.528E-48	398	0.387	0.450	2c9oA.pdb.gz	Crystal structure of the human AAA+ protein RuvBL1.
19	PDB:6igmF	0.628	0.777	4.684E-48	366	0.784	0.992	6igmF.pdb.gz
20	PDB:6fhsC	0.659	0.664	1.300E-47	459	0.410	0.414	6fhsC.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G0RYC2	0.0	647	488	0.657	0.623	G0RYC2_CHATD RuvB-like helicase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0006170 PE=1 SV=1
2	M0R0Y3	0.0	666	354	0.711	0.929	M0R0Y3_HUMAN RuvB-like helicase OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=1
3	O94692	0.0	680	465	0.678	0.675	RUVB2_SCHPO RuvB-like helicase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rvb2 PE=1 SV=1
4	P83571	0.0	838	463	0.883	0.883	RUVB2_DANRE RuvB-like 2 OS=Danio rerio OX=7955 GN=ruvbl2 PE=1 SV=1
5	Q12464	0.0	652	471	0.661	0.650	RUVB2_YEAST RuvB-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RVB2 PE=1 SV=1
6	Q4QQS4	0.0	934	463	0.994	0.994	Q4QQS4_RAT RuvB-like helicase OS=Rattus norvegicus OX=10116 GN=Ruvbl2 PE=1 SV=1
7	Q583J3	0.0	665	474	0.702	0.686	Q583J3_TRYB2 RuvB-like helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.640 PE=3 SV=1
8	Q8ID85	0.0	633	483	0.665	0.638	Q8ID85_PLAF7 RuvB-like helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1362200 PE=3 SV=1
9	Q9DE27	0.0	895	462	0.940	0.942	RUVB2_XENLA RuvB-like 2 OS=Xenopus laevis OX=8355 GN=ruvbl2 PE=2 SV=1
10	Q9FJW0	0.0	701	469	0.741	0.731	Q9FJW0_ARATH RuvB-like helicase OS=Arabidopsis thaliana OX=3702 GN=ISE4 PE=1 SV=1
11	Q9GZH2	0.0	570	448	0.568	0.587	RUVB2_CAEEL RuvB-like 2 OS=Caenorhabditis elegans OX=6239 GN=ruvb-2 PE=1 SV=1
12	Q9M2X5	0.0	677	473	0.691	0.677	Q9M2X5_ARATH RuvB-like helicase OS=Arabidopsis thaliana OX=3702 GN=T16K5.180 PE=1 SV=1
13	Q9V3K3	0.0	745	481	0.765	0.736	RUVB2_DROME RuvB-like helicase 2 OS=Drosophila melanogaster OX=7227 GN=rept PE=1 SV=1
14	Q9WTM5	0.0	935	463	0.996	0.996	RUVB2_MOUSE RuvB-like 2 OS=Mus musculus OX=10090 GN=Ruvbl2 PE=1 SV=3
15	Q9Y230	0.0	938	463	1.000	1.000	RUVB2_HUMAN RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3
16	P60122	6.89e-131	388	456	0.421	0.428	RUVB1_MOUSE RuvB-like 1 OS=Mus musculus OX=10090 GN=Ruvbl1 PE=1 SV=1
17	P60123	6.89e-131	388	456	0.421	0.428	RUVB1_RAT RuvB-like 1 OS=Rattus norvegicus OX=10116 GN=Ruvbl1 PE=1 SV=1
18	Q581V4	8.28e-131	388	459	0.443	0.447	Q581V4_TRYB2 RuvB-like helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.390 PE=3 SV=1
19	A0A384MTR5	9.54e-131	387	456	0.421	0.428	A0A384MTR5_HUMAN RuvB-like helicase OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q9Y265	9.54e-131	387	456	0.421	0.428	RUVB1_HUMAN RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	7.4e-06	37.9	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	2.2e+02	13.0	AAA domain
3	PF13191 AAA_16	0.002	30.0	AAA ATPase domain
4	PF13245 AAA_19	1.6	20.4	AAA domain
5	PF13401 AAA_22	0.23	23.2	AAA domain
6	PF13476 AAA_23	1.3e+02	14.6	AAA domain
7	PF13481 AAA_25	8.9	17.3	AAA domain
8	PF13604 AAA_30	85	14.3	AAA domain
9	PF07728 AAA_5	0.025	26.0	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	50	14.9	P-loop containing dynein motor region
11	PF06745 ATPase	6.5	17.6	KaiC
12	PF20030 bpMoxR	1.4e+02	12.9	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
13	PF03796 DnaB_C	0.016	26.1	DnaB-like helicase C terminal domain
14	PF09848 DUF2075	42	14.8	Schlafen group 3, DNA/RNA helicase domain
15	PF01078 Mg_chelatase	0.76	20.7	Magnesium chelatase, subunit ChlI
16	PF00924 MS_channel	2.6e+02	12.6	Mechanosensitive ion channel
17	PF05729 NACHT	67	14.8	NACHT domain
18	PF02562 PhoH	3.3e+02	12.1	PhoH-like protein
19	PF04851 ResIII	5.9e+02	11.9	Type III restriction enzyme, res subunit
20	PF05496 RuvB_N	0.015	26.5	Holliday junction DNA helicase RuvB P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010366915.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354947.1	0.999	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
2	61622.XP_010352428.1	0.998	RNA polymerase II-associated protein 3 isoform X1
3	61622.XP_010367340.1	0.995	INO80 complex subunit
4	61622.XP_010367767.1	0.995	PIH1 domain-containing protein 1 isoform X1
5	61622.XP_010377546.1	0.995	INO80 complex subunit B
6	61622.XP_010353655.1	0.994	Belongs to the actin family.
7	61622.XP_010361005.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 45 ESTs, 2 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments
8	61622.XP_010364766.1	0.994	Belongs to the MYST (SAS/MOZ) family.
9	61622.XP_010370213.1	0.994	DNA methyltransferase 1-associated protein 1 isoform X1
10	61622.XP_010373853.1	0.994	Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform X1
11	61622.XP_010385699.1	0.993	Zinc finger HIT domain-containing protein 1
12	61622.XP_010360523.1	0.992	Snf2 related CREBBP activator protein
13	61622.XP_010372176.1	0.991	Belongs to the actin family.
14	61622.XP_010381871.1	0.991	Belongs to the actin family.
15	61622.XP_010374483.1	0.990	Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize
16	61622.XP_010357042.1	0.989	YEATS domain containing 4
17	61622.XP_010353638.1	0.988	TELO2 interacting protein 1
18	61622.XP_010385511.1	0.987	Vacuolar protein sorting-associated protein 72 homolog
19	61622.XP_010386121.1	0.986	Telomere length regulation protein TEL2 homolog isoform X1
20	61622.XP_010352017.1	0.985	Transcriptional repressor protein YY1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0042802	0.977	identical protein binding
GO:0003824	0.960	catalytic activity
GO:0140657	0.958	ATP-dependent activity
GO:0003712	0.929	transcription coregulator activity
GO:0016887	0.866	ATP hydrolysis activity
GO:0140640	0.793	catalytic activity, acting on a nucleic acid
GO:1901363	0.787	heterocyclic compound binding
GO:0097159	0.787	organic cyclic compound binding
GO:0008134	0.784	transcription factor binding
GO:0140097	0.781	catalytic activity, acting on DNA
GO:0003678	0.771	DNA helicase activity
GO:0140296	0.640	general transcription initiation factor binding
GO:0003676	0.603	nucleic acid binding
GO:0017025	0.429	TBP-class protein binding
GO:0003714	0.418	transcription corepressor activity
GO:0003690	0.396	double-stranded DNA binding
GO:0043565	0.395	sequence-specific DNA binding
GO:0000976	0.390	transcription cis-regulatory region binding
GO:0000987	0.313	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0016043	0.941	cellular component organization
GO:0009889	0.878	regulation of biosynthetic process
GO:0010468	0.846	regulation of gene expression
GO:0019219	0.846	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.844	regulation of macromolecule biosynthetic process
GO:0031326	0.844	regulation of cellular biosynthetic process
GO:0071704	0.745	organic substance metabolic process
GO:0051252	0.736	regulation of RNA metabolic process
GO:0044238	0.720	primary metabolic process
GO:0006807	0.709	nitrogen compound metabolic process
GO:0048518	0.699	positive regulation of biological process
GO:2001141	0.660	regulation of RNA biosynthetic process
GO:0006355	0.651	regulation of DNA-templated transcription
GO:0044237	0.608	cellular metabolic process
GO:0010604	0.608	positive regulation of macromolecule metabolic process
GO:0043170	0.596	macromolecule metabolic process
GO:0048522	0.587	positive regulation of cellular process
GO:0051173	0.562	positive regulation of nitrogen compound metabolic process
GO:0034641	0.544	cellular nitrogen compound metabolic process
GO:0031325	0.543	positive regulation of cellular metabolic process
GO:0006139	0.517	nucleobase-containing compound metabolic process
GO:0045935	0.510	positive regulation of nucleobase-containing compound metabolic process
GO:0090304	0.468	nucleic acid metabolic process
GO:0048583	0.358	regulation of response to stimulus
GO:0048519	0.348	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005694	0.992	chromosome
GO:0005829	0.985	cytosol
GO:0140513	0.983	nuclear protein-containing complex
GO:0000785	0.981	chromatin
GO:1902494	0.977	catalytic complex
GO:0000228	0.969	nuclear chromosome
GO:0070603	0.952	SWI/SNF superfamily-type complex
GO:0097346	0.934	INO80-type complex
GO:0000812	0.889	Swr1 complex
GO:0031011	0.846	Ino80 complex
GO:0140535	0.685	intracellular protein-containing complex
GO:1990234	0.598	transferase complex
GO:0034708	0.383	methyltransferase complex
GO:0035097	0.367	histone methyltransferase complex
GO:0065010	0.359	extracellular membrane-bounded organelle
GO:1990904	0.356	ribonucleoprotein complex
GO:0044665	0.345	MLL1/2 complex
GO:1903561	0.343	extracellular vesicle
GO:0071339	0.343	MLL1 complex
GO:0000123	0.324	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.866	ATP + H2O = ADP + H(+) + phosphate

[back to server]