StarFunc result for job id Q9Y231

User Input

>input (359 residues)
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDY
FNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNL
PQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVF
EVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKF
YLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAK
YLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88819	0.964	0.964	1.070E-77	359	0.994	0.994	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
2	AFDB:P22083	0.777	0.531	1.892E-40	530	0.407	0.275	P22083.pdb.gz	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
3	AFDB:Q11127	0.793	0.661	1.065E-39	433	0.412	0.342	Q11127.pdb.gz	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
4	AFDB:Q62994	0.764	0.639	1.336E-38	433	0.398	0.330	Q62994.pdb.gz	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
5	AFDB:P51993	0.795	0.795	1.512E-38	359	0.384	0.384	P51993.pdb.gz	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
6	AFDB:Q11128	0.797	0.766	1.677E-37	374	0.376	0.361	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
7	AFDB:G3MZR2	0.789	0.827	1.004E-36	342	0.365	0.383	G3MZR2.pdb.gz	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
8	AFDB:Q11130	0.781	0.819	1.068E-36	342	0.359	0.377	Q11130.pdb.gz	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
9	AFDB:Q11131	0.787	0.729	1.068E-36	389	0.326	0.301	Q11131.pdb.gz	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
10	AFDB:Q712G6	0.778	0.755	1.208E-36	370	0.343	0.332	Q712G6.pdb.gz	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
11	PDB:7au2A	0.385	0.238	1.144E-4	686	0.120	0.063	7au2A.pdb.gz
12	PDB:7sckB	0.329	0.226	4.178E-4	598	0.117	0.070	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
13	PDB:1ixyA	0.345	0.352	4.930E-3	351	0.103	0.105	1ixyA.pdb.gz	A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
14	PDB:4nc9A	0.321	0.314	5.244E-3	369	0.111	0.108	4nc9A.pdb.gz
15	PDB:7jlxA	0.168	0.305	9.720E-3	166	0.067	0.145	7jlxA.pdb.gz
16	PDB:4w6qD	0.391	0.416	1.694E-2	332	0.097	0.105	4w6qD.pdb.gz	A conserved domain is crucial for acceptor substrate binding in a family of glucosyltransferases.
17	PDB:5e9uA	0.306	0.234	1.801E-2	503	0.078	0.056	5e9uA.pdb.gz	Mechanism of a cytosolic O-glycosyltransferase essential for the synthesis of a bacterial adhesion protein.
18	PDB:4njmA	0.177	0.199	2.452E-2	303	0.078	0.092	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
19	PDB:7anwA	0.194	0.122	4.273E-2	645	0.056	0.031	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
20	PDB:4ptyD	0.177	0.297	4.545E-2	175	0.056	0.114	4ptyD.pdb.gz	Crystal Structure of Escherichia coli SsuE: Defining a General Catalytic Cycle for FMN Reductases of the Flavodoxin-like Superfamily.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88819	0.0	747	359	0.994	0.994	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
2	Q99JB3	0.0	742	359	0.986	0.986	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
3	Q9Y231	0.0	749	359	1.000	1.000	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
4	Q11127	2.49e-83	261	433	0.396	0.328	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
5	Q62994	5.20e-81	255	433	0.401	0.333	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
6	Q11128	1.13e-80	253	374	0.365	0.350	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
7	Q9P1W6	1.19e-80	252	361	0.368	0.366	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
8	P21217	1.33e-80	252	361	0.368	0.366	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
9	P51993	2.73e-80	251	359	0.370	0.370	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
10	Q6P7E6	9.14e-80	249	359	0.368	0.368	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
11	P22083	9.28e-80	255	530	0.390	0.264	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
12	Q11130	4.25e-76	240	342	0.359	0.377	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
13	G3MZR2	6.92e-74	234	342	0.345	0.363	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
14	Q712G6	9.43e-72	229	370	0.343	0.332	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
15	Q11131	9.15e-69	222	389	0.326	0.301	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
16	Q9VUL9	2.63e-31	125	503	0.256	0.183	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
17	G5EEE1	6.91e-26	108	392	0.226	0.207	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1
18	G5EFP5	1.13e-25	108	400	0.284	0.255	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1
19	G5EDR5	9.85e-23	100	433	0.231	0.192	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
20	G5EE06	6.72e-22	97.8	378	0.231	0.220	FUTD_CAEEL Alpha-(1,3)-fucosyltransferase fut-5 OS=Caenorhabditis elegans OX=6239 GN=fut-5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	3.1e-63	224.2	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	2.2e-37	139.3	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006156168.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006160248.1	0.994	Galactoside 2-alpha-L-fucosyltransferase 1 isoform X1
2	246437.XP_006153828.1	0.988	Beta-1,4-galactosyltransferase 2
3	246437.XP_006163178.1	0.987	Beta-1,4-galactosyltransferase 3
4	246437.XP_006143293.1	0.986	Beta-1,4-galactosyltransferase 1
5	246437.XP_006160962.1	0.983	Galactoside 2-alpha-L-fucosyltransferase 2-like
6	246437.XP_006149348.1	0.932	Hexosyltransferase
7	246437.XP_006163979.1	0.932	Type 2 lactosamine alpha-2,3-sialyltransferase
8	246437.XP_006171668.1	0.918	Histo-blood group ABO system transferase-like
9	246437.XP_006171669.1	0.918	Histo-blood group ABO system transferase-like
10	246437.XP_006152279.1	0.916	Hexosyltransferase
11	246437.XP_006167693.1	0.916	Beta-1,4-galactosyltransferase 4 isoform X1
12	246437.XP_006147239.1	0.915	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
13	246437.XP_006150545.1	0.915	N-acetyllactosaminide alpha-1,3-galactosyltransferase-like isoform X1
14	246437.XP_006141271.1	0.908	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C-like isoform X1
15	246437.XP_006141311.1	0.908	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform B-like
16	246437.XP_006162655.1	0.906	Alpha-(1,3)-fucosyltransferase 4
17	246437.XP_006140682.1	0.905	ST3 beta-galactoside alpha-2,3-sialyltransferase 4
18	246437.XP_006153821.1	0.862	CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
19	246437.XP_006142734.1	0.848	Belongs to the glycosyltransferase 29 family.
20	246437.XP_006139852.1	0.718	CMP-N-acetylneuraminate-poly-alpha-2, 8-sialyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0017083	0.890	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity
GO:0005515	0.718	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.987	cellular biosynthetic process
GO:0070085	0.986	glycosylation
GO:0006807	0.985	nitrogen compound metabolic process
GO:1901137	0.981	carbohydrate derivative biosynthetic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0005975	0.979	carbohydrate metabolic process
GO:0016051	0.974	carbohydrate biosynthetic process
GO:0009059	0.969	macromolecule biosynthetic process
GO:0009100	0.968	glycoprotein metabolic process
GO:0043412	0.967	macromolecule modification
GO:0006486	0.960	protein glycosylation
GO:0009311	0.947	oligosaccharide metabolic process
GO:0032502	0.945	developmental process
GO:0032501	0.922	multicellular organismal process
GO:0048856	0.920	anatomical structure development
GO:0009312	0.874	oligosaccharide biosynthetic process
GO:0007275	0.838	multicellular organism development
GO:0048731	0.812	system development
GO:0007399	0.789	nervous system development
GO:0065007	0.467	biological regulation
GO:0050789	0.463	regulation of biological process
GO:0050794	0.423	regulation of cellular process
GO:0006643	0.410	membrane lipid metabolic process
GO:0006493	0.390	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.996	membrane
GO:0031090	0.964	organelle membrane
GO:0000139	0.917	Golgi membrane
GO:0098791	0.564	Golgi apparatus subcompartment
GO:0005802	0.420	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14257	0.890	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+)
EC:2.4.1.152	0.890	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.

[back to server]