StarFunc result for job id Q9Y232

User Input

>input (598 residues)
MTFQASHRSAWGKSRKKNWQYEGPTQKLFLKRNNVSAPDGPSDPSISVSSEQSGAQQPPA
LQVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKES
TLTRTNRTSPNNARKQISRSTNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPS
LSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKP
VGALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLAVNGKGTSPFMDALTANGTTN
IQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTK
SSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRES
TKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKEL
ASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y232	1.000	1.000	5.507E-96	598	1.000	1.000	Q9Y232.pdb.gz	CDYL_HUMAN Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2
2	AFDB:Q9WTK2	0.652	0.657	2.375E-81	593	0.856	0.863	Q9WTK2.pdb.gz	CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus OX=10090 GN=Cdyl PE=1 SV=1
3	AFDB:Q9Y6F7	0.467	0.514	1.025E-60	541	0.564	0.623	Q9Y6F7.pdb.gz	CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens OX=9606 GN=CDY2A PE=1 SV=1
4	AFDB:Q8N8U2	0.448	0.528	2.819E-52	506	0.438	0.518	Q8N8U2.pdb.gz	CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens OX=9606 GN=CDYL2 PE=1 SV=2
5	AFDB:Q9WUR2	0.406	0.618	3.742E-28	391	0.164	0.251	Q9WUR2.pdb.gz	ECI2_MOUSE Enoyl-CoA delta isomerase 2 OS=Mus musculus OX=10090 GN=Eci2 PE=1 SV=2
6	AFDB:O75521	0.411	0.620	1.287E-27	394	0.172	0.261	O75521.pdb.gz	ECI2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4
7	AFDB:Q5XIC0	0.402	0.610	1.088E-26	391	0.162	0.248	Q5XIC0.pdb.gz	ECI2_RAT Enoyl-CoA delta isomerase 2 OS=Rattus norvegicus OX=10116 GN=Eci2 PE=1 SV=1
8	AFDB:Q09603	0.419	0.646	7.342E-26	385	0.129	0.200	Q09603.pdb.gz	Q09603_CAEEL ACB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ech-4 PE=1 SV=1
9	AFDB:Q78JN3	0.408	0.757	1.287E-25	317	0.157	0.297	Q78JN3.pdb.gz	ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus OX=10090 GN=Eci3 PE=1 SV=1
10	AFDB:Q8MR61	0.418	0.924	8.691E-24	265	0.122	0.275	Q8MR61.pdb.gz	Q8MR61_DROME GH11143p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dci PE=2 SV=1
11	PDB:2hw5C	0.340	0.752	9.801E-17	260	0.104	0.238	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
12	PDB:1jxzB	0.344	0.741	1.160E-16	269	0.105	0.234	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis
13	PDB:5dtwC	0.355	0.807	2.407E-16	246	0.097	0.236	5dtwC.pdb.gz	THPP target assignment reveals EchA6 as an essential fatty acid shuttle in mycobacteria.
14	PDB:1k39B	0.392	0.838	2.694E-16	271	0.102	0.225	1k39B.pdb.gz	Crystallization and X-ray diffraction analysis of peroxisomal Delta3-Delta2-enoyl-CoA isomerase from Saccharomyces cerevisiae
15	PDB:4fzwB	0.321	0.729	3.991E-16	256	0.112	0.262	4fzwB.pdb.gz
16	PDB:1dubA	0.331	0.726	5.590E-16	260	0.107	0.246	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
17	PDB:3h81A	0.344	0.777	6.616E-16	256	0.099	0.230	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
18	PDB:5zaiC	0.347	0.776	7.830E-16	259	0.095	0.220	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
19	PDB:1szoD	0.360	0.809	2.547E-15	251	0.090	0.215	1szoD.pdb.gz	Structure of 6-oxo camphor hydrolase H122A mutant bound to its natural product, (2S,4S)-alpha-campholinic acid: mutant structure suggests an atypical mode of transition state binding for a crotonase homolog.
20	PDB:4izcB	0.352	0.759	3.773E-15	266	0.085	0.192	4izcB.pdb.gz	Crystal Structure of DmdD, a Crotonase Superfamily Enzyme That Catalyzes the Hydration and Hydrolysis of Methylthioacryloyl-CoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9WTK2	0.0	1056	593	0.858	0.865	CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus OX=10090 GN=Cdyl PE=1 SV=1
2	Q9Y232	0.0	1244	598	1.000	1.000	CDYL_HUMAN Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2
3	Q9Y6F7	0.0	714	541	0.572	0.632	CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens OX=9606 GN=CDY2A PE=1 SV=1
4	Q9Y6F8	0.0	714	540	0.575	0.637	CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens OX=9606 GN=CDY1 PE=1 SV=1
5	Q8N8U2	7.62e-170	494	506	0.457	0.540	CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens OX=9606 GN=CDYL2 PE=1 SV=2
6	Q9D5D8	1.11e-169	494	503	0.446	0.531	CDYL2_MOUSE Chromodomain Y-like protein 2 OS=Mus musculus OX=10090 GN=Cdyl2 PE=1 SV=1
7	A0A0C4DGA2	4.86e-56	195	364	0.166	0.272	A0A0C4DGA2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=1
8	Q9WUR2	1.07e-55	195	391	0.166	0.253	ECI2_MOUSE Enoyl-CoA delta isomerase 2 OS=Mus musculus OX=10090 GN=Eci2 PE=1 SV=2
9	O75521	1.60e-55	194	394	0.166	0.251	ECI2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4
10	Q5XIC0	8.28e-53	187	391	0.161	0.246	ECI2_RAT Enoyl-CoA delta isomerase 2 OS=Rattus norvegicus OX=10116 GN=Eci2 PE=1 SV=1
11	Q78JN3	1.81e-49	176	317	0.157	0.297	ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus OX=10090 GN=Eci3 PE=1 SV=1
12	Q09603	2.22e-32	130	385	0.124	0.192	Q09603_CAEEL ACB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ech-4 PE=1 SV=1
13	Q8MR61	3.34e-28	115	265	0.124	0.279	Q8MR61_DROME GH11143p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dci PE=2 SV=1
14	Q9W0M0	4.47e-28	115	262	0.124	0.282	Q9W0M0_DROME Dodecenoyl-CoA delta-isomerase OS=Drosophila melanogaster OX=7227 GN=Dci PE=1 SV=1
15	P76082	2.95e-20	92.8	255	0.125	0.294	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
16	Q9FHR8	1.03e-18	89.0	278	0.107	0.230	DCI1_ARATH Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=1 SV=1
17	Q13011	2.45e-18	88.6	328	0.110	0.201	ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2
18	P14604	2.84e-18	87.8	290	0.079	0.162	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
19	Q8BH95	3.43e-18	87.4	290	0.080	0.166	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
20	O35459	3.50e-18	88.2	327	0.129	0.235	ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus OX=10090 GN=Ech1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	1.1e-14	65.3	Chromo (CHRromatin Organisation MOdifier) domain
2	PF00378 ECH_1	6.4e-31	119.1	Enoyl-CoA hydratase/isomerase
3	PF16113 ECH_2	8.1e-14	63.5	Enoyl-CoA hydratase/isomerase
4	PF14061 Mtf2_C	27	16.4	Polycomb-like MTF2 factor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030202

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000001282	0.872	Sterol carrier protein 2
2	9598.ENSPTRP00000024332	0.864	Zinc finger protein 280B
3	9598.ENSPTRP00000050361	0.855	Euchromatic histone-lysine N-methyltransferase 2
4	9598.ENSPTRP00000048599	0.854	Euchromatic histone-lysine N-methyltransferase 1
5	9598.ENSPTRP00000024333	0.829	Zinc finger protein 280A
6	9598.ENSPTRP00000009272	0.794	Acyl-CoA dehydrogenase family member 10
7	9598.ENSPTRP00000033970	0.755	Enhancer of zeste homolog 2
8	9598.ENSPTRP00000058647	0.750	Pan troglodytes hydroxysteroid dehydrogenase like 2 (HSDL2), mRNA
9	9598.ENSPTRP00000025446	0.735	Acetyl-CoA acyltransferase 1
10	9598.ENSPTRP00000049696	0.735	Histone deacetylase
11	9598.ENSPTRP00000018140	0.732	Ribosomal protein L23a
12	9598.ENSPTRP00000029578	0.727	Ubiquitin-conjugating enzyme E2D 2
13	9598.ENSPTRP00000042719	0.724	Mesoderm induction early response 1 homolog
14	9598.ENSPTRP00000018130	0.718	Uncharacterized protein
15	9598.ENSPTRP00000051798	0.710	Histone-lysine N-methyltransferase
16	9598.ENSPTRP00000037544	0.677	Histone-lysine N-methyltransferase
17	9598.ENSPTRP00000039650	0.677	Histone-lysine N-methyltransferase
18	9598.ENSPTRP00000060697	0.654	Hydroxyacyl-thioester dehydratase type 2
19	9598.ENSPTRP00000060659	0.649	Histone deacetylase
20	9598.ENSPTRP00000016254	0.644	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140030	0.997	modification-dependent protein binding
GO:0003824	0.996	catalytic activity
GO:0042393	0.977	histone binding
GO:0035064	0.968	methylated histone binding
GO:0016829	0.922	lyase activity
GO:0042802	0.908	identical protein binding
GO:0016836	0.888	hydro-lyase activity
GO:0003676	0.629	nucleic acid binding
GO:0140110	0.477	transcription regulator activity
GO:0003712	0.456	transcription coregulator activity
GO:0060090	0.406	molecular adaptor activity
GO:0003714	0.387	transcription corepressor activity
GO:0030674	0.344	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0032502	0.987	developmental process
GO:0048232	0.987	male gamete generation
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0007283	0.982	spermatogenesis
GO:0080090	0.924	regulation of primary metabolic process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0048519	0.888	negative regulation of biological process
GO:0009987	0.877	cellular process
GO:0010605	0.863	negative regulation of macromolecule metabolic process
GO:0051172	0.829	negative regulation of nitrogen compound metabolic process
GO:0051246	0.691	regulation of protein metabolic process
GO:0031400	0.588	negative regulation of protein modification process
GO:0010468	0.372	regulation of gene expression
GO:0050794	0.371	regulation of cellular process
GO:0071840	0.340	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.833	cytoplasm
GO:0016604	0.518	nuclear body
GO:0043232	0.410	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.922	Lyases.
EC:4.2.1.-	0.888	Hydro-lyases.

[back to server]