StarFunc result for job id Q9Y233

User Input

>input (779 residues)
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QYJ6	0.913	0.896	0.000	794	0.941	0.923	Q9QYJ6.pdb.gz	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
2	AFDB:P91119	0.612	0.652	7.963E-56	728	0.352	0.376	P91119.pdb.gz	PDE5_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-5 OS=Caenorhabditis elegans OX=6239 GN=pde-5 PE=3 SV=3
3	AFDB:Q8VID6	0.755	0.636	4.832E-50	935	0.299	0.249	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
4	AFDB:Q9VJ79	0.760	0.425	1.635E-49	1451	0.291	0.156	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
5	AFDB:Q9VFI9	0.725	0.519	3.008E-49	1118	0.295	0.206	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
6	AFDB:O76074	0.692	0.623	2.133E-46	875	0.300	0.267	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
7	AFDB:B3VTJ2	0.413	0.349	2.573E-46	941	0.284	0.235	B3VTJ2.pdb.gz	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
8	AFDB:Q38F46	0.390	0.328	7.807E-43	930	0.254	0.213	Q38F46.pdb.gz	Q38F46_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3590 PE=3 SV=1
9	AFDB:P16499	0.619	0.569	2.642E-42	860	0.241	0.219	P16499.pdb.gz	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
10	AFDB:P51160	0.600	0.552	2.902E-42	858	0.245	0.223	P51160.pdb.gz	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
11	PDB:7jsnA	0.614	0.588	2.788E-38	820	0.248	0.235	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
12	PDB:6mzbB	0.644	0.625	1.997E-37	807	0.241	0.233	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
13	PDB:3bjcA	0.374	0.910	1.456E-21	311	0.157	0.392	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
14	PDB:4y86B	0.378	0.886	1.076E-17	326	0.104	0.248	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
15	PDB:1f5mB	0.165	0.615	1.767E-4	177	0.041	0.181	1f5mB.pdb.gz
16	PDB:1vhmB	0.142	0.601	4.731E-4	160	0.030	0.144	1vhmB.pdb.gz
17	PDB:7rzwB	0.161	0.146	1.050E-3	864	0.042	0.038	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:4zmuA	0.159	0.343	1.266E-3	341	0.050	0.114	4zmuA.pdb.gz
19	PDB:5loeA	0.137	0.369	1.044E-2	258	0.036	0.109	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:2w1tA	0.116	0.443	2.545E-2	175	0.031	0.137	2w1tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CA95	0.0	1551	790	0.940	0.927	PDE10_MOUSE cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Mus musculus OX=10090 GN=Pde10a PE=1 SV=2
2	Q9QYJ6	0.0	1553	794	0.940	0.922	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
3	Q9Y233	0.0	1635	779	1.000	1.000	PDE10_HUMAN cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Homo sapiens OX=9606 GN=PDE10A PE=1 SV=1
4	P91119	2.80e-162	489	728	0.300	0.321	PDE5_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-5 OS=Caenorhabditis elegans OX=6239 GN=pde-5 PE=3 SV=3
5	Q9VJ79	6.13e-118	390	1451	0.285	0.153	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
6	Q8VID6	3.25e-115	373	935	0.264	0.220	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
7	Q9HCR9	7.41e-115	372	933	0.266	0.222	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
8	Q9VFI9	4.57e-113	371	1118	0.281	0.196	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
9	O54735	5.02e-109	353	833	0.273	0.256	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
10	Q8CG03	8.74e-108	351	865	0.273	0.246	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
11	O76074	3.14e-106	347	875	0.275	0.245	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
12	P14099	2.83e-103	340	921	0.270	0.228	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2
13	G1U4Q4	2.91e-103	341	936	0.272	0.226	G1U4Q4_RABIT Phosphodiesterase OS=Oryctolagus cuniculus OX=9986 GN=PDE2A PE=3 SV=2
14	Q01062	1.49e-101	336	928	0.271	0.227	PDE2A_RAT cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde2a PE=1 SV=2
15	O00408	3.14e-101	335	941	0.266	0.220	PDE2A_HUMAN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE2A PE=1 SV=1
16	Q922S4	8.66e-101	334	939	0.271	0.225	PDE2A_MOUSE cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde2a PE=1 SV=4
17	B3VTJ2	1.76e-100	333	941	0.266	0.220	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
18	Q38F42	1.11e-86	296	925	0.258	0.217	Q38F42_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3630 PE=1 SV=1
19	Q9GQU6	1.14e-80	279	930	0.254	0.213	Q9GQU6_9TRYP Phosphodiesterase OS=Trypanosoma brucei OX=5691 GN=PDE PE=3 SV=1
20	Q8WQX9	7.62e-80	277	930	0.254	0.213	Q8WQX9_9TRYP Phosphodiesterase OS=Trypanosoma brucei OX=5691 GN=PDEB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	6.9e-25	99.7	GAF domain
2	PF13185 GAF_2	5.1e-13	60.9	GAF domain
3	PF13492 GAF_3	1.7e-06	39.9	GAF domain
4	PF01966 HD	30	16.3	HD domain
5	PF00233 PDEase_I	1.2e-65	233.1	3'5'-cyclic nucleotide phosphodiesterase
6	PF12282 PdtaS_GAF	3.1e+02	12.7	Histidine kinase PdtaS, GAF domain
7	PF15714 SpoVT_C	0.37	22.3	Stage V sporulation protein T C-terminal, transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438284

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485525	0.914	Adenylosuccinate lyase
2	9606.ENSP00000286621	0.906	Adenosine kinase
3	9606.ENSP00000286648	0.902	Deoxycytidine kinase
4	9606.ENSP00000371230	0.902	GTP:AMP phosphotransferase AK3, mitochondrial
5	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
6	9606.ENSP00000359719	0.854	cAMP-dependent protein kinase catalytic subunit beta
7	9606.ENSP00000419361	0.850	Adenylate cyclase type 5
8	9606.ENSP00000309591	0.849	cAMP-dependent protein kinase catalytic subunit alpha
9	9606.ENSP00000366488	0.849	cAMP-dependent protein kinase catalytic subunit gamma
10	9606.ENSP00000297323	0.833	Adenylate cyclase type 1
11	9606.ENSP00000286355	0.817	Adenylate cyclase type 8
12	9606.ENSP00000386181	0.798	Tetratricopeptide repeat protein 30B
13	9606.ENSP00000356825	0.792	Adenylate cyclase type 10
14	9606.ENSP00000311453	0.788	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
15	9606.ENSP00000282249	0.787	Guanylate cyclase soluble subunit alpha-2
16	9606.ENSP00000264917	0.778	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
17	9606.ENSP00000260600	0.772	Adenylate cyclase type 3
18	9606.ENSP00000264424	0.751	Guanylate cyclase soluble subunit beta-1
19	9606.ENSP00000294016	0.749	Adenylate cyclase type 9
20	9606.ENSP00000312126	0.749	Adenylate cyclase type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004112	0.998	cyclic-nucleotide phosphodiesterase activity
GO:0004114	0.994	3',5'-cyclic-nucleotide phosphodiesterase activity
GO:0005488	0.964	binding
GO:0005515	0.800	protein binding
GO:0043167	0.741	ion binding
GO:0000166	0.561	nucleotide binding
GO:0043168	0.520	anion binding
GO:0017076	0.510	purine nucleotide binding
GO:0097367	0.500	carbohydrate derivative binding
GO:0032555	0.491	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0048583	0.971	regulation of response to stimulus
GO:0023051	0.913	regulation of signaling
GO:0010646	0.910	regulation of cell communication
GO:0009966	0.840	regulation of signal transduction
GO:1902531	0.694	regulation of intracellular signal transduction
GO:0009987	0.678	cellular process
GO:0050896	0.499	response to stimulus
GO:0051716	0.430	cellular response to stimulus
GO:0007165	0.347	signal transduction
GO:0048519	0.331	negative regulation of biological process
GO:0048523	0.309	negative regulation of cellular process
GO:0008277	0.304	regulation of G protein-coupled receptor signaling pathway
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0016020	0.981	membrane
GO:0043226	0.741	organelle
GO:0043227	0.731	membrane-bounded organelle
GO:0043229	0.582	intracellular organelle
GO:0071944	0.521	cell periphery
GO:0005886	0.509	plasma membrane
GO:0036477	0.453	somatodendritic compartment
GO:0043025	0.311	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.998	Phosphoric diester hydrolases.
RHEA:14653	0.994	a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+)
EC:3.1.4.17	0.994	3',5'-cyclic-nucleotide phosphodiesterase.

[back to server]