StarFunc result for job id Q9Y238

User Input

>input (1755 residues)
METRSSKTRRSLASRTNECQGTMWAPTSPPAGSSSPSQPTWKSSLYSSLAYSEAFHYSFA
ARPRRLTQLALAQRPEPQLLRLRPSSLRTQDISHLLTGVFRNLYSAEVIGDEVSASLIKA
RGSENERHEEFVDQLQQIRELYKQRLDEFEMLERHITQAQARAIAENERVMSQAGVQDLE
SLVRLPPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEK
RSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRNKN
WMNHLRVPQRELDRLLLARMESRNHFLKNPRFFPPNTRYGGKSLVFPPKKPAPIGEFQST
EPEQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGL
GMFPGKGGMVAPGMTCQYIVQFFPDCLGDFDDFILVETQSAHTLLIPLQARRPPPVLTLS
PVLDCGYCLIGGVKMTRFICKNVGFSVGRFCIMPKTSWPPLSFKAIATVGFVEQPPFGIL
PSVFELAPGHAILVEVLFSPKSLGKAEQTFIIMCDNCQIKELVTIGIGQLIALDLIYISG
EKSQPDPGELTDLTAQHFIRFEPENLRSTARKQLIIRNATHVELAFYWQIMKPNLQPLMP
GETFSMDSIKCYPDKETAFSIMPRKGVLSPHTDHEFILSFSPHELRDFHSVLQMVLEEVP
EPVSSEAESLGHSSYSVDDVIVLEIEVKGSVEPFQVLLEPYALIIPGENYIGINVKKAFK
MWNNSKSPIRYLWGKISDCHIIEVEPGTGVIEPSEVGDFELNFTGGVPGPTSQDLLCEIE
DSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMKESPV
SLQERPEDVSPFDIEPSSGQLHSLGECRVDITLEALHCQHLETVLELEVENGAWSYLPVY
AEVQKPHVYLQSSQVEVRNLYLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVS
PKHGLLGPSEECQLKLELTAHTQEELTHLALPCHVSGMKKPLVLGISGKPQGLQVAITIS
KESSDCSTEQWPGHPKELRLDFGSAVPLRTRVTRQLILTNRSPIRTRFSLKFEYFGSPQN
SLSKKTSLPNMPPALLKTVRMQEHLAKREQLDFMESMLSHGKGAAFFPHFSQGMLGPYQQ
LCIDITGCANMWGEYWDNLICTVGDLLPEVIPVHMAAVGCPISSLRTTSYTIDQAQKEPA
MRFGTQVSGGDTVTRTLRLNNSSPCDIRLDWETYVPEDKEDRLVELLVFYGPPFPLRDQA
GNELVCPDTPEGGCLLWSPGPSSSSEFSHETDSSVEGSSSASNRVAQKLISVILQAHEGV
PSGHLYCISPKQVVVPAGGSSTIYISFTPMVLSPEILHKVECTGYALGFMSLDSKVEREI
PGKRHRLQDFAVGPLKLDLHSYVRPAQLSVELDYGGSMEFQCQASDLIPEQPCSGVLSEL
VTTHHLKLTNTTEIPHYFRLMVSRPFSVSQDGASQDHRAPGPGQKQECEEETASADKQLV
LQAQENMLVNVSFSLSLELLSYQKLPADQTLPGVDIQQSASGEREMVFTQNLLLEYTNQT
TQVVPLRAVVAVPELQLSTSWVDFGTCFVSQQRVREVYLMNLSGCRSYWTMLMGQQEPAK
AAVAFRVSPNSGLLEARSANAPPTSIALQVFFTARSSELYESTMVVEGVLGEKSCTLRLR
GQGSYDERYMLPHQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y238	1.000	1.000	0.000	1755	1.000	1.000	Q9Y238.pdb.gz	DLEC1_HUMAN Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=1 SV=2
2	AFDB:Q57XV2	0.229	0.186	2.360E-75	2327	0.173	0.131	Q57XV2.pdb.gz	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
3	AFDB:Q8BLA1	0.150	0.385	9.221E-72	635	0.246	0.680	Q8BLA1.pdb.gz	DLEC1_MOUSE Deleted in lung and esophageal cancer protein 1 homolog OS=Mus musculus OX=10090 GN=Dlec1 PE=1 SV=1
4	AFDB:Q6ZU64	0.193	0.177	3.054E-63	1925	0.128	0.117	Q6ZU64.pdb.gz	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
5	AFDB:Q38AM8	0.202	0.199	2.850E-58	1794	0.100	0.098	Q38AM8.pdb.gz	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
6	AFDB:D4P3R7	0.127	0.117	8.479E-52	1940	0.141	0.128	D4P3R7.pdb.gz	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
7	AFDB:Q388P3	0.131	0.182	1.132E-51	1046	0.086	0.144	Q388P3.pdb.gz	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
8	PDB:7sqcO0	0.124	0.170	3.621E-49	1140	0.081	0.125	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	AFDB:E9Q4Y4	0.128	0.095	1.108E-46	2514	0.124	0.086	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
10	AFDB:Q18264	0.103	0.099	2.306E-35	1831	0.081	0.078	Q18264.pdb.gz	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
11	AFDB:Q54NE5	0.082	0.076	1.013E-27	1918	0.110	0.101	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
12	PDB:5a42A	0.075	0.081	1.109E-19	1597	0.067	0.074	5a42A.pdb.gz
13	PDB:7q1yA	0.086	0.101	6.260E-19	1374	0.059	0.076	7q1yA.pdb.gz
14	PDB:7q5zA	0.074	0.092	6.929E-18	1344	0.054	0.070	7q5zA.pdb.gz
15	PDB:4lnvA	0.085	0.104	2.094E-17	1276	0.064	0.088	4lnvA.pdb.gz
16	PDB:6h03A	0.091	0.108	4.105E-17	1223	0.061	0.087	6h03A.pdb.gz
17	PDB:7vonA	0.093	0.111	1.823E-16	1399	0.062	0.078	7vonA.pdb.gz
18	PDB:4ziqA	0.060	0.069	3.424E-15	1450	0.072	0.088	4ziqA.pdb.gz
19	PDB:7nycA	0.073	0.080	5.538E-15	1542	0.058	0.066	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7sqcO1	0.111	0.230	8.537E-15	673	0.034	0.088	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BLA1	0.0	880	635	0.243	0.672	DLEC1_MOUSE Deleted in lung and esophageal cancer protein 1 homolog OS=Mus musculus OX=10090 GN=Dlec1 PE=1 SV=1
2	Q9Y238	0.0	3621	1755	1.000	1.000	DLEC1_HUMAN Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=1 SV=2
3	Q4G0P3	3.83e-25	117	5121	0.099	0.034	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
4	Q80W93	3.49e-22	107	5154	0.096	0.033	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
5	A8J6X7	1.04e-09	65.9	645	0.021	0.056	PCDP1_CHLRE Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1
6	A9Q751	8.45e-09	63.2	836	0.034	0.071	PCDP1_MOUSE Cilia- and flagella-associated protein 221 OS=Mus musculus OX=10090 GN=Cfap221 PE=1 SV=1
7	Q583L9	2.41e-08	62.0	4521	0.093	0.036	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
8	Q57XV2	0.001	46.6	2327	0.021	0.016	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
9	A8JFU2	0.002	45.8	2118	0.038	0.032	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
10	Q38AM8	0.002	45.4	1794	0.050	0.048	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
11	Q9U2R6	0.002	45.1	474	0.032	0.118	NHR91_CAEEL Nuclear hormone receptor family member nhr-91 OS=Caenorhabditis elegans OX=6239 GN=nhr-91 PE=1 SV=2
12	Q8IFM1	0.13	39.3	622	0.018	0.050	Q8IFM1_PLAF7 Serine/threonine protein kinase, FIKK family OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424500 PE=4 SV=1
13	Q3V0B4	0.25	38.9	1847	0.024	0.023	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
14	Q583U1	0.28	38.5	2728	0.012	0.008	Q583U1_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.330 PE=4 SV=1
15	A0A0G2JEB6	0.38	38.1	3184	0.020	0.011	CFA47_MOUSE Cilia and flagella-associated protein 47 OS=Mus musculus OX=10090 GN=Cfap47 PE=1 SV=2
16	Q388P3	0.95	37.0	1046	0.022	0.036	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
17	Q6ZU64	0.97	37.0	1925	0.011	0.010	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
18	J9VRH3	1.7	35.8	420	0.009	0.036	J9VRH3_CRYNH ADP-ribosylation factor GTPase-activating protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_05050 PE=4 SV=1
19	D4P3R7	3.9	35.0	1940	0.019	0.018	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
20	Q6ZTR5	4.9	34.7	3187	0.017	0.009	CFA47_HUMAN Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	2.6e-12	58.1	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF09321 DUF1978	35	15.2	Domain of unknown function (DUF1978)
3	PF14874 PapD-like	0.008	27.7	Flagellar-associated PapD-like
4	PF12371 TMEM131_like_N	1.1	20.9	Transmembrane protein 131-like N-terminal
5	PF10400 Vir_act_alpha_C	4.6e+02	12.9	Virulence activator alpha C-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217254	0.736	Solute carrier family 52, riboflavin transporter, member 3
2	9606.ENSP00000371000	0.722	E3 ubiquitin-protein ligase RNF6
3	9606.ENSP00000357691	0.720	Protein S100-A14
4	9606.ENSP00000370981	0.720	Leucine zipper putative tumor suppressor 1
5	9606.ENSP00000434727	0.628	Coiled-coil domain containing 180
6	9606.ENSP00000349547	0.618	Ras association domain-containing protein 1
7	9606.ENSP00000297866	0.611	Cilia- and flagella-associated protein 47
8	9606.ENSP00000360431	0.610	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
9	9606.ENSP00000311713	0.580	Serine/threonine-protein kinase OSR1
10	9606.ENSP00000321475	0.557	Kelch-like protein 38
11	9606.ENSP00000268613	0.556	Cadherin-13
12	9606.ENSP00000430344	0.550	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
13	9606.ENSP00000306606	0.539	Alcohol dehydrogenase 1B, beta polypeptide
14	9606.ENSP00000340776	0.538	Cilia- and flagella-associated protein 65
15	9606.ENSP00000303222	0.517	Mitochondrial carrier homolog 2
16	9606.ENSP00000392395	0.508	E3 ubiquitin-protein ligase CHFR
17	9606.ENSP00000265843	0.506	Exophilin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048487	1.000	beta-tubulin binding
GO:0043014	1.000	alpha-tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048523	0.970	negative regulation of cellular process
GO:0042127	0.968	regulation of cell population proliferation
GO:0050896	0.967	response to stimulus
GO:0008285	0.694	negative regulation of cell population proliferation
GO:0009987	0.653	cellular process
GO:0006950	0.609	response to stress
GO:0006952	0.405	defense response
GO:0032501	0.310	multicellular organismal process
GO:0009607	0.300	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.952	organelle
GO:0043227	0.940	membrane-bounded organelle
GO:0043229	0.913	intracellular organelle
GO:0016020	0.600	membrane
GO:0043231	0.559	intracellular membrane-bounded organelle
GO:0043232	0.421	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]