StarFunc result for job id Q9Y239

User Input

>input (953 residues)
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ADT7	0.579	0.579	0.000	953	0.817	0.817	D4ADT7.pdb.gz	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
2	AFDB:Q9Y239	1.000	1.000	0.000	953	1.000	1.000	Q9Y239.pdb.gz	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1
3	AFDB:A0A0K0KIB0	0.567	0.566	1.519E-93	954	0.515	0.515	A0A0K0KIB0.pdb.gz	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
4	AFDB:X1WGQ4	0.827	0.871	1.004E-80	903	0.454	0.480	X1WGQ4.pdb.gz
5	AFDB:F8W3K2	0.512	0.499	7.683E-62	980	0.322	0.313	F8W3K2.pdb.gz	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
6	AFDB:Q6E804	0.550	0.520	3.208E-60	1013	0.328	0.309	Q6E804.pdb.gz	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
7	AFDB:Q8K3Z0	0.547	0.513	1.129E-59	1020	0.339	0.317	Q8K3Z0.pdb.gz	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
8	AFDB:Q9HC29	0.544	0.501	1.335E-59	1040	0.338	0.310	Q9HC29.pdb.gz	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
9	AFDB:A0A0G2K4Z7	0.526	0.508	1.285E-58	989	0.325	0.313	A0A0G2K4Z7.pdb.gz	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
10	AFDB:Q96P20	0.442	0.418	1.278E-36	1036	0.218	0.201	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
11	PDB:7pzcA	0.412	0.392	4.425E-26	1010	0.206	0.194	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:4kxfP	0.255	0.277	3.987E-20	866	0.175	0.193	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
13	PDB:7lfhA	0.359	0.410	9.222E-20	806	0.184	0.217	7lfhA.pdb.gz
14	PDB:6npyA	0.297	0.328	2.133E-19	798	0.189	0.226	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
15	PDB:3jblA	0.377	0.393	2.273E-13	909	0.173	0.182	3jblA.pdb.gz
16	PDB:6b5bA	0.336	0.275	3.202E-11	1199	0.153	0.122	6b5bA.pdb.gz
17	PDB:1a4yA	0.217	0.380	1.277E-10	460	0.095	0.198	1a4yA.pdb.gz
18	PDB:6o60C	0.254	0.562	2.048E-7	389	0.068	0.167	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:5yudA	0.339	0.273	2.864E-7	1238	0.149	0.115	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
20	PDB:5juyB	0.221	0.185	8.171E-7	1234	0.092	0.071	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060X8V7	0.0	984	951	0.507	0.508	A0A060X8V7_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047677001 PE=4 SV=1
2	A0A0K0KIB0	0.0	981	954	0.506	0.505	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
3	D4ADT7	0.0	1597	953	0.815	0.815	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
4	Q8BHB0	0.0	1567	953	0.815	0.815	NOD1_MOUSE Nucleotide-binding oligomerization domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nod1 PE=1 SV=1
5	Q9Y239	0.0	1966	953	1.000	1.000	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1
6	F8W3K2	2.41e-156	488	980	0.324	0.315	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
7	A0A0G2K4Z7	2.55e-144	457	1034	0.339	0.312	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
8	Q8K3Z0	9.13e-144	456	1020	0.340	0.318	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
9	Q80SY9	1.01e-143	455	1013	0.340	0.320	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
10	Q9HC29	1.42e-141	450	1040	0.344	0.315	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
11	Q6E804	9.65e-139	442	1013	0.339	0.319	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
12	D4A5W3	1.20e-126	408	932	0.303	0.310	D4A5W3_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=1
13	C3VPR7	1.99e-48	189	1065	0.220	0.197	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
14	Q7RTR2	1.99e-48	189	1065	0.220	0.197	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
15	H3BLT9	2.50e-48	189	1112	0.220	0.189	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
16	P59046	1.87e-39	160	1061	0.208	0.187	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
17	Q5DU56	3.26e-39	160	1064	0.210	0.188	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
18	Q96P20	3.15e-33	141	1036	0.198	0.182	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
19	E9Q5R7	3.26e-32	137	1054	0.200	0.181	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
20	Q8R4B8	6.17e-32	137	1033	0.195	0.180	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	17	17.2	AAA ATPase domain
2	PF13238 AAA_18	96	15.0	AAA domain
3	PF13401 AAA_22	1.9e+02	13.7	AAA domain
4	PF13481 AAA_25	3.3e+02	12.2	AAA domain
5	PF00005 ABC_tran	1.2e+02	14.6	ABC transporter
6	PF00619 CARD	2.5e-15	67.6	Caspase recruitment domain
7	PF12799 LRR_4	8.1e-09	46.9	Leucine Rich repeats (2 copies)
8	PF13516 LRR_6	1.6e-18	76.1	Leucine Rich repeat
9	PF13855 LRR_8	1.2e+02	13.8	Leucine rich repeat
10	PF05729 NACHT	3.2e-38	142.7	NACHT domain
11	PF17776 NLRC4_HD2	5.6e-15	67.5	NLRC4 helical domain HD2
12	PF17779 NOD2_WH	5e-06	38.0	NOD2 winged helix domain
13	PF08477 Roc	4.7e+02	12.4	Ras of Complex, Roc, domain of DAPkinase
14	PF03193 RsgA_GTPase	1.6e+02	13.6	RsgA GTPase
15	PF08032 SpoU_sub_bind	1.1e+02	14.5	RNA 2'-O ribose methyltransferase substrate binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220751	0.999	Receptor-interacting serine/threonine-protein kinase 2
2	9606.ENSP00000375872	0.998	Autophagy-related protein 16-1
3	9606.ENSP00000354837	0.980	Rho guanine nucleotide exchange factor 2
4	9606.ENSP00000335153	0.977	Heat shock protein HSP 90-alpha
5	9606.ENSP00000433138	0.973	Caspase-1
6	9606.ENSP00000367208	0.950	Protein SGT1 homolog
7	9606.ENSP00000477613	0.944	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000359424	0.943	Inhibitor of nuclear factor kappa-B kinase subunit alpha
9	9606.ENSP00000430684	0.943	Inhibitor of nuclear factor kappa-B kinase subunit beta
10	9606.ENSP00000263464	0.942	Baculoviral IAP repeat-containing protein 3
11	9606.ENSP00000441543	0.932	Polyubiquitin-C
12	9606.ENSP00000392025	0.927	Ubiquitin carboxyl-terminal hydrolase CYLD
13	9606.ENSP00000481570	0.924	Tumor necrosis factor alpha-induced protein 3
14	9606.ENSP00000480499	0.919	E3 ubiquitin-protein ligase Itchy homolog
15	9606.ENSP00000410402	0.910	Dual specificity mitogen-activated protein kinase kinase 4
16	9606.ENSP00000345083	0.909	Dual specificity mitogen-activated protein kinase kinase 3
17	9606.ENSP00000381070	0.906	Dual specificity mitogen-activated protein kinase kinase 7
18	9606.ENSP00000468348	0.903	Dual specificity mitogen-activated protein kinase kinase 6
19	9606.ENSP00000360797	0.894	Caspase recruitment domain-containing protein 9
20	9606.ENSP00000401980	0.882	Mitochondrial antiviral-signaling protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140677	0.973	molecular function activator activity
GO:0097367	0.972	carbohydrate derivative binding
GO:0019904	0.959	protein domain specific binding
GO:0038023	0.954	signaling receptor activity
GO:0046983	0.951	protein dimerization activity
GO:0016504	0.950	peptidase activator activity
GO:0038187	0.922	pattern recognition receptor activity
GO:0042803	0.922	protein homodimerization activity
GO:0042834	0.918	peptidoglycan binding
GO:0043028	0.899	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0016505	0.889	peptidase activator activity involved in apoptotic process
GO:0008656	0.868	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0050700	0.691	CARD domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048583	0.982	regulation of response to stimulus
GO:0050896	0.980	response to stimulus
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0009987	0.977	cellular process
GO:0048522	0.976	positive regulation of cellular process
GO:0001817	0.975	regulation of cytokine production
GO:0001819	0.969	positive regulation of cytokine production
GO:0051716	0.965	cellular response to stimulus
GO:0048584	0.960	positive regulation of response to stimulus
GO:0009966	0.960	regulation of signal transduction
GO:1903555	0.960	regulation of tumor necrosis factor superfamily cytokine production
GO:0031323	0.954	regulation of cellular metabolic process
GO:0031347	0.949	regulation of defense response
GO:0007154	0.946	cell communication
GO:0002682	0.946	regulation of immune system process
GO:0043123	0.946	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051171	0.945	regulation of nitrogen compound metabolic process
GO:0009607	0.944	response to biotic stimulus
GO:0002684	0.943	positive regulation of immune system process
GO:0023052	0.940	signaling
GO:0031349	0.940	positive regulation of defense response
GO:0032651	0.936	regulation of interleukin-1 beta production
GO:0009605	0.931	response to external stimulus
GO:0065009	0.924	regulation of molecular function
GO:0032103	0.921	positive regulation of response to external stimulus
GO:0032732	0.921	positive regulation of interleukin-1 production
GO:0006950	0.919	response to stress
GO:0002831	0.919	regulation of response to biotic stimulus
GO:0032680	0.917	regulation of tumor necrosis factor production
GO:0043207	0.916	response to external biotic stimulus
GO:1903557	0.910	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0051707	0.906	response to other organism
GO:0051090	0.899	regulation of DNA-binding transcription factor activity
GO:0006952	0.893	defense response
GO:0032760	0.886	positive regulation of tumor necrosis factor production
GO:0098542	0.882	defense response to other organism
GO:0045088	0.882	regulation of innate immune response
GO:0044093	0.881	positive regulation of molecular function
GO:0032731	0.881	positive regulation of interleukin-1 beta production
GO:0045089	0.870	positive regulation of innate immune response
GO:0002253	0.868	activation of immune response
GO:0051091	0.864	positive regulation of DNA-binding transcription factor activity
GO:0002218	0.864	activation of innate immune response
GO:0035556	0.858	intracellular signal transduction
GO:0043410	0.857	positive regulation of MAPK cascade
GO:0002697	0.846	regulation of immune effector process
GO:0043085	0.845	positive regulation of catalytic activity
GO:0009617	0.840	response to bacterium
GO:0002764	0.834	immune response-regulating signaling pathway
GO:0002700	0.830	regulation of production of molecular mediator of immune response
GO:0002699	0.825	positive regulation of immune effector process
GO:0002702	0.823	positive regulation of production of molecular mediator of immune response
GO:0002718	0.821	regulation of cytokine production involved in immune response
GO:0002221	0.820	pattern recognition receptor signaling pathway
GO:0032757	0.819	positive regulation of interleukin-8 production
GO:0051173	0.808	positive regulation of nitrogen compound metabolic process
GO:0051092	0.807	positive regulation of NF-kappaB transcription factor activity
GO:0032874	0.800	positive regulation of stress-activated MAPK cascade
GO:0046330	0.794	positive regulation of JNK cascade
GO:0002720	0.786	positive regulation of cytokine production involved in immune response
GO:0071310	0.779	cellular response to organic substance
GO:0052548	0.776	regulation of endopeptidase activity
GO:0051247	0.745	positive regulation of protein metabolic process
GO:0031325	0.734	positive regulation of cellular metabolic process
GO:1901222	0.733	regulation of NIK/NF-kappaB signaling
GO:0010950	0.700	positive regulation of endopeptidase activity
GO:1901699	0.697	cellular response to nitrogen compound
GO:1901224	0.673	positive regulation of NIK/NF-kappaB signaling
GO:1901700	0.656	response to oxygen-containing compound
GO:0009595	0.656	detection of biotic stimulus
GO:0008152	0.655	metabolic process
GO:0010941	0.634	regulation of cell death
GO:0098581	0.561	detection of external biotic stimulus
GO:0010243	0.513	response to organonitrogen compound
GO:0042742	0.485	defense response to bacterium
GO:0071704	0.475	organic substance metabolic process
GO:0044238	0.461	primary metabolic process
GO:0043067	0.445	regulation of programmed cell death
GO:1901652	0.437	response to peptide
GO:0044237	0.427	cellular metabolic process
GO:0006955	0.396	immune response
GO:0006807	0.377	nitrogen compound metabolic process
GO:0048519	0.377	negative regulation of biological process
GO:2000116	0.355	regulation of cysteine-type endopeptidase activity
GO:0043170	0.349	macromolecule metabolic process
GO:0048523	0.324	negative regulation of cellular process
GO:2001056	0.315	positive regulation of cysteine-type endopeptidase activity
GO:0042981	0.314	regulation of apoptotic process
GO:1901564	0.305	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.988	cytosol
GO:0016020	0.956	membrane
GO:0071944	0.936	cell periphery
GO:0005886	0.923	plasma membrane
GO:0043229	0.866	intracellular organelle
GO:0043231	0.846	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]