StarFunc result for job id Q9Y243

User Input

>input (479 residues)
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1MYJ4	0.963	0.963	6.808E-84	479	1.000	1.000	F1MYJ4.pdb.gz	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
2	AFDB:Q8UUX0	0.954	0.954	3.947E-75	479	0.781	0.781	Q8UUX0.pdb.gz	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
3	AFDB:A0A0B8RZS0	0.924	0.920	1.775E-73	481	0.772	0.769	A0A0B8RZS0.pdb.gz	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
4	AFDB:M4MD44	0.899	0.908	1.855E-72	474	0.808	0.816	M4MD44.pdb.gz	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
5	AFDB:B0LPE5	0.932	0.930	4.272E-72	480	0.827	0.825	B0LPE5.pdb.gz	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
6	AFDB:Q8INB9	0.841	0.669	5.003E-66	611	0.647	0.507	Q8INB9.pdb.gz	AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Akt PE=1 SV=3
7	AFDB:Q17941	0.871	0.774	3.302E-60	541	0.559	0.495	Q17941.pdb.gz	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
8	AFDB:M0R0P9	0.649	0.690	1.551E-57	450	0.651	0.693	M0R0P9.pdb.gz	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
9	PDB:6s9wA	0.555	0.638	1.303E-54	411	0.739	0.861	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
10	PDB:6hhgA	0.542	0.662	6.504E-53	386	0.701	0.870	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
11	PDB:5kcvA	0.537	0.718	8.230E-50	353	0.635	0.861	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
12	AFDB:P54644	0.669	0.721	6.523E-48	444	0.409	0.441	P54644.pdb.gz	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
13	AFDB:Q7ZTW4	0.671	0.741	9.254E-40	433	0.363	0.402	Q7ZTW4.pdb.gz	SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio OX=7955 GN=sgk1 PE=2 SV=1
14	PDB:3pfqA	0.616	0.565	1.073E-31	523	0.338	0.310	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:6byrA	0.612	0.721	2.227E-31	405	0.273	0.323	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
16	PDB:5x3fB	0.560	0.761	2.096E-30	349	0.263	0.361	5x3fB.pdb.gz
17	PDB:3pvuA	0.560	0.444	9.849E-28	609	0.230	0.181	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4yhjA	0.578	0.553	1.347E-27	501	0.240	0.230	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:4mk0A	0.584	0.450	1.419E-27	631	0.236	0.179	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:6pjxA	0.592	0.525	5.504E-27	543	0.236	0.208	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B8RZS0	785	481	0.783	0.780	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
2	B0LPE5	826	480	0.829	0.827	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
3	C1PIG3	815	480	0.816	0.815	C1PIG3_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
4	E1B9D1	697	438	0.704	0.769	E1B9D1_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT2 PE=3 SV=2
5	F1MYJ4	1001	479	1.000	1.000	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
6	G3X7B5	816	480	0.820	0.819	G3X7B5_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=3 SV=2
7	G9BWQ1	817	480	0.818	0.817	G9BWQ1_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
8	G9BWQ2	785	481	0.783	0.780	G9BWQ2_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=AKT2 PE=2 SV=1
9	J3QKW1	638	396	0.649	0.785	J3QKW1_HUMAN AKT serine/threonine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
10	M0R0P9	657	450	0.651	0.693	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
11	M4MD44	806	474	0.814	0.823	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
12	O57513	840	480	0.843	0.842	O57513_CHICK RAC-alpha serine/threonine-protein kinase OS=Gallus gallus OX=9031 GN=akt1 PE=1 SV=1
13	P31749	826	480	0.829	0.827	AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2
14	P31750	825	480	0.827	0.825	AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt1 PE=1 SV=2
15	P31751	786	481	0.781	0.778	AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
16	P47196	824	480	0.825	0.823	AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt1 PE=1 SV=1
17	P47197	778	481	0.775	0.771	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
18	Q01314	819	480	0.823	0.821	AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=1 SV=2
19	Q17941	559	541	0.566	0.501	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
20	Q60823	783	481	0.779	0.775	AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.4e+02	13.0	ABC1 atypical kinase-like domain
2	PF13095 FTA2	13	16.9	Kinetochore Sim4 complex subunit FTA2
3	PF14531 Kinase-like	0.00016	32.7	Kinase-like
4	PF00169 PH	2.6e-11	55.3	PH domain
5	PF15413 PH_11	4.5e+02	12.7	Pleckstrin homology domain
6	PF20399 PH_20	2.1e+02	13.4	PH domain
7	PF00069 Pkinase	3.5e-74	261.1	Protein kinase domain
8	PF00433 Pkinase_C	0.00024	33.0	Protein kinase C terminal domain
9	PF07714 PK_Tyr_Ser-Thr	4.6e-33	126.2	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010640899.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010624969.1	0.996	Mitogen-activated protein kinase kinase kinase 5
2	885580.XP_010633603.1	0.988	Forkhead box protein O3
3	885580.XP_010626424.1	0.986	Belongs to the PI3/PI4-kinase family.
4	885580.XP_010643189.1	0.984	PH domain leucine-rich repeat-containing protein phosphatase 1
5	885580.XP_010637477.1	0.982	Forkhead box protein O1
6	885580.XP_010642512.1	0.982	E3 ubiquitin-protein ligase Mdm2 isoform X1
7	885580.XP_010642768.1	0.980	PH domain leucine-rich repeat-containing protein phosphatase 2 isoform X1
8	885580.XP_010621677.1	0.979	Glycogen synthase kinase-3 alpha
9	885580.XP_010636699.1	0.977	Cyclin-dependent kinase inhibitor 1B
10	885580.XP_010601839.1	0.976	3-phosphoinositide-dependent protein kinase 1 isoform X1
11	885580.XP_010625715.1	0.976	Hamartin
12	885580.XP_010628317.1	0.976	Glycogen synthase kinase-3 beta isoform X1
13	885580.XP_010634388.1	0.973	Bcl2 antagonist of cell death
14	885580.XP_010635875.1	0.973	Produces nitric oxide (NO)
15	885580.XP_010641289.1	0.973	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
16	885580.XP_010626779.1	0.971	Bcl-2-like protein 1
17	885580.XP_010632357.1	0.971	Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
18	885580.XP_010637128.1	0.971	Cyclin-dependent kinase inhibitor 1 isoform X1
19	885580.XP_010642546.1	0.971	Integrin-linked protein kinase
20	885580.XP_010613193.1	0.966	Acts as a tumor suppressor in many tumor types

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0043167	0.886	ion binding
GO:0043168	0.723	anion binding
GO:1901363	0.708	heterocyclic compound binding
GO:0097159	0.688	organic cyclic compound binding
GO:0019899	0.488	enzyme binding
GO:0036094	0.439	small molecule binding
GO:0017076	0.430	purine nucleotide binding
GO:0035639	0.427	purine ribonucleoside triphosphate binding
GO:0032555	0.418	purine ribonucleotide binding
GO:0005524	0.406	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0009987	0.984	cellular process
GO:0050896	0.979	response to stimulus
GO:0051716	0.921	cellular response to stimulus
GO:0008152	0.877	metabolic process
GO:0048522	0.862	positive regulation of cellular process
GO:0019222	0.818	regulation of metabolic process
GO:0071704	0.767	organic substance metabolic process
GO:0044238	0.761	primary metabolic process
GO:0007165	0.746	signal transduction
GO:0043170	0.734	macromolecule metabolic process
GO:0044237	0.723	cellular metabolic process
GO:0048519	0.719	negative regulation of biological process
GO:0006807	0.707	nitrogen compound metabolic process
GO:0031323	0.693	regulation of cellular metabolic process
GO:1901564	0.690	organonitrogen compound metabolic process
GO:0019538	0.637	protein metabolic process
GO:0060255	0.636	regulation of macromolecule metabolic process
GO:0006796	0.623	phosphate-containing compound metabolic process
GO:0036211	0.603	protein modification process
GO:0080090	0.598	regulation of primary metabolic process
GO:0051171	0.574	regulation of nitrogen compound metabolic process
GO:0009893	0.565	positive regulation of metabolic process
GO:0023051	0.538	regulation of signaling
GO:0010646	0.535	regulation of cell communication
GO:0016310	0.520	phosphorylation
GO:0048523	0.512	negative regulation of cellular process
GO:0048583	0.498	regulation of response to stimulus
GO:0051239	0.464	regulation of multicellular organismal process
GO:0009966	0.459	regulation of signal transduction
GO:0042221	0.455	response to chemical
GO:0070887	0.445	cellular response to chemical stimulus
GO:0010604	0.445	positive regulation of macromolecule metabolic process
GO:0031325	0.414	positive regulation of cellular metabolic process
GO:0006950	0.397	response to stress
GO:0051173	0.392	positive regulation of nitrogen compound metabolic process
GO:0031326	0.392	regulation of cellular biosynthetic process
GO:0006468	0.392	protein phosphorylation
GO:0032501	0.381	multicellular organismal process
GO:0032502	0.371	developmental process
GO:0010468	0.366	regulation of gene expression
GO:0035556	0.336	intracellular signal transduction
GO:0065009	0.327	regulation of molecular function
GO:1901653	0.327	cellular response to peptide
GO:1902531	0.319	regulation of intracellular signal transduction
GO:0071375	0.319	cellular response to peptide hormone stimulus
GO:0071840	0.312	cellular component organization or biogenesis
GO:0048856	0.310	anatomical structure development
GO:0050793	0.309	regulation of developmental process
GO:0051246	0.307	regulation of protein metabolic process
GO:0032879	0.306	regulation of localization
GO:0010556	0.302	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.996	membrane
GO:0005654	0.995	nucleoplasm
GO:0005829	0.985	cytosol
GO:0005886	0.949	plasma membrane
GO:0032991	0.325	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]