StarFunc result for job id Q9Y244

User Input

>input (141 residues)
MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQD
KMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILND
PSQSEVMGEPHLMVEYKLGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQT5	0.781	0.781	3.286E-18	141	0.950	0.950	Q9CQT5.pdb.gz	POMP_MOUSE Proteasome maturation protein OS=Mus musculus OX=10090 GN=Pomp PE=1 SV=1
2	AFDB:Q9VIJ5	0.632	0.662	1.856E-8	134	0.383	0.403	Q9VIJ5.pdb.gz	Q9VIJ5_DROME GEO05038p1 OS=Drosophila melanogaster OX=7227 GN=Pomp PE=1 SV=1
3	AFDB:P38293	0.574	0.549	2.712E-4	148	0.262	0.250	P38293.pdb.gz	UMP1_YEAST Proteasome maturation factor UMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UMP1 PE=1 SV=1
4	PDB:7ls6H	0.511	0.592	3.771E-4	118	0.191	0.229	7ls6H.pdb.gz
5	AFDB:O74416	0.499	0.542	4.084E-4	129	0.248	0.271	O74416.pdb.gz	UMP1_SCHPO Probable proteasome maturation factor ump1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ump1 PE=3 SV=1
6	AFDB:Q387Z7	0.333	0.365	7.435E-2	124	0.106	0.121	Q387Z7.pdb.gz	Q387Z7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1370 PE=4 SV=1
7	PDB:2fsfB	0.156	0.050	2.733	723	0.092	0.018	2fsfB.pdb.gz
8	AFDB:Q68EL6	0.206	0.076	3.964	462	0.135	0.041	Q68EL6.pdb.gz	NFIL3_DANRE Nuclear factor interleukin-3-regulated protein OS=Danio rerio OX=7955 GN=nfil3 PE=2 SV=1
9	PDB:7nsuD	0.109	0.054	4.115	420	0.142	0.048	7nsuD.pdb.gz
10	PDB:3ik7A	0.144	0.094	5.199	221	0.128	0.081	3ik7A.pdb.gz	Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
11	PDB:2b5uA	0.117	0.043	6.569	470	0.135	0.040	2b5uA.pdb.gz
12	AFDB:Q0VGM9	0.210	0.038	6.710	1203	0.142	0.017	Q0VGM9.pdb.gz	RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus OX=10090 GN=Rtel1 PE=1 SV=2
13	AFDB:Q6P933	0.218	0.062	7.114	609	0.142	0.033	Q6P933.pdb.gz	Q6P933_DANRE Si:dkey-52h23.1 protein (Fragment) OS=Danio rerio OX=7955 GN=si:dkey-52h23.1 PE=2 SV=1
14	PDB:1b48A	0.122	0.081	7.384	221	0.113	0.072	1b48A.pdb.gz	Crystal structure of a murine glutathione S-transferase in complex with a glutathione conjugate of 4-hydroxynon-2-enal in one subunit and glutathione in the other: evidence of signaling across the dimer interface.
15	PDB:7ktrE	0.190	0.210	7.384	124	0.050	0.056	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
16	PDB:7mq8SM	0.142	0.075	7.384	290	0.092	0.045	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:O14521	0.173	0.160	7.542	159	0.121	0.107	O14521.pdb.gz	DHSD_HUMAN Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHD PE=1 SV=1
18	AFDB:P29503	0.172	0.042	7.996	754	0.135	0.025	P29503.pdb.gz	NEUR_DROME Protein neuralized OS=Drosophila melanogaster OX=7227 GN=neur PE=1 SV=2
19	PDB:1w36B	0.209	0.034	8.300	1158	0.106	0.013	1w36B.pdb.gz	Crystal Structure of Recbcd Enzyme Reveals a Machine for Processing DNA Breaks
20	PDB:2fshA	0.160	0.052	9.329	691	0.085	0.017	2fshA.pdb.gz	Structure of dimeric SecA, the Escherichia coli preprotein translocase motor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y244	1.37e-99	283	141	1.000	1.000	POMP_HUMAN Proteasome maturation protein OS=Homo sapiens OX=9606 GN=POMP PE=1 SV=1
2	Q9CQT5	5.34e-95	272	141	0.950	0.950	POMP_MOUSE Proteasome maturation protein OS=Mus musculus OX=10090 GN=Pomp PE=1 SV=1
3	Q9VIJ5	1.08e-23	91.3	134	0.362	0.381	Q9VIJ5_DROME GEO05038p1 OS=Drosophila melanogaster OX=7227 GN=Pomp PE=1 SV=1
4	O74416	1.23e-07	49.7	129	0.206	0.225	UMP1_SCHPO Probable proteasome maturation factor ump1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ump1 PE=3 SV=1
5	P38293	7.24e-06	45.1	148	0.220	0.209	UMP1_YEAST Proteasome maturation factor UMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UMP1 PE=1 SV=1
6	P38141	1.1	31.2	450	0.142	0.044	THI2_YEAST Thiamine biosynthesis regulatory protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THI2 PE=4 SV=1
7	Q9R1Q9	1.6	30.8	463	0.156	0.048	VAS1_MOUSE V-type proton ATPase subunit S1 OS=Mus musculus OX=10090 GN=Atp6ap1 PE=1 SV=1
8	O54715	1.8	30.8	463	0.156	0.048	VAS1_RAT V-type proton ATPase subunit S1 OS=Rattus norvegicus OX=10116 GN=Atp6ap1 PE=1 SV=1
9	Q8NFT8	2.8	30.0	737	0.106	0.020	DNER_HUMAN Delta and Notch-like epidermal growth factor-related receptor OS=Homo sapiens OX=9606 GN=DNER PE=1 SV=1
10	P33937	3.4	30.0	828	0.099	0.017	NAPA_ECOLI Periplasmic nitrate reductase OS=Escherichia coli (strain K12) OX=83333 GN=napA PE=1 SV=3
11	Q15904	6.5	28.9	470	0.156	0.047	VAS1_HUMAN V-type proton ATPase subunit S1 OS=Homo sapiens OX=9606 GN=ATP6AP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05348 UMP1	1.5e-32	123.6	Proteasome maturation factor UMP1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000684

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000338	0.986	Proteasome (prosome, macropain) subunit, beta type, 1
2	61853.ENSNLEP00000013474	0.981	Proteasome (prosome, macropain) subunit, beta type, 2
3	61853.ENSNLEP00000012443	0.980	Proteasome (prosome, macropain) subunit, beta type, 4
4	61853.ENSNLEP00000021487	0.980	Proteasome subunit alpha type
5	61853.ENSNLEP00000018291	0.979	Proteasome endopeptidase complex
6	61853.ENSNLEP00000003464	0.977	Proteasome (prosome, macropain) subunit, alpha type, 5
7	61853.ENSNLEP00000000693	0.961	Proteasome (prosome, macropain) subunit, beta type, 3
8	61853.ENSNLEP00000011044	0.956	Proteasome assembly chaperone 2
9	61853.ENSNLEP00000008235	0.947	Proteasome (prosome, macropain) subunit, beta type, 9
10	61853.ENSNLEP00000007974	0.936	Proteasome (prosome, macropain) subunit, alpha type, 8
11	61853.ENSNLEP00000019131	0.936	Proteasome (prosome, macropain) subunit, alpha type, 7
12	61853.ENSNLEP00000020984	0.934	Proteasome (prosome, macropain) subunit, beta type, 7
13	61853.ENSNLEP00000015936	0.923	Proteasome (prosome, macropain) subunit, alpha type, 3
14	61853.ENSNLEP00000021123	0.923	Proteasome (prosome, macropain) subunit, beta type, 6
15	61853.ENSNLEP00000006110	0.921	Proteasome (prosome, macropain) subunit, beta type, 10
16	61853.ENSNLEP00000008201	0.912	Proteasome (prosome, macropain) subunit, beta type, 8
17	61853.ENSNLEP00000004474	0.905	Proteasome (prosome, macropain) subunit, alpha type, 6
18	61853.ENSNLEP00000002958	0.899	annotation not available
19	61853.ENSNLEP00000003863	0.899	Proteasome subunit alpha type
20	61853.ENSNLEP00000011332	0.864	Proteasome (prosome, macropain) 26S subunit, ATPase, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065003	0.985	protein-containing complex assembly
GO:0008152	0.601	metabolic process
GO:0071704	0.571	organic substance metabolic process
GO:0043170	0.522	macromolecule metabolic process
GO:0006807	0.415	nitrogen compound metabolic process
GO:0065007	0.412	biological regulation
GO:0050789	0.385	regulation of biological process
GO:0044238	0.374	primary metabolic process
GO:0043248	0.345	proteasome assembly
GO:0044237	0.332	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.952	cytoplasm
GO:0005829	0.932	cytosol
GO:0016604	0.719	nuclear body
GO:0016607	0.662	nuclear speck
GO:0032991	0.449	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]