StarFunc result for job id Q9Y248

User Input

>input (185 residues)
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y248	1.000	1.000	9.217E-35	185	1.000	1.000	Q9Y248.pdb.gz	PSF2_HUMAN DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1
2	AFDB:Q7ZT46	0.947	0.947	7.250E-30	185	0.859	0.859	Q7ZT46.pdb.gz	PSF2_XENLA DNA replication complex GINS protein PSF2 OS=Xenopus laevis OX=8355 GN=gins2 PE=1 SV=1
3	PDB:2ehoG	0.913	0.959	1.695E-28	176	0.946	0.994	2ehoG.pdb.gz
4	AFDB:Q9VQY9	0.919	0.839	4.543E-21	203	0.411	0.374	Q9VQY9.pdb.gz	PSF2_DROME Probable DNA replication complex GINS protein PSF2 OS=Drosophila melanogaster OX=7227 GN=Psf2 PE=1 SV=1
5	AFDB:O94329	0.849	0.858	1.571E-16	183	0.319	0.322	O94329.pdb.gz	PSF2_SCHPO DNA replication complex GINS protein psf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf2 PE=1 SV=1
6	PDB:6raxL	0.825	0.825	9.397E-15	185	0.411	0.411	6raxL.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
7	AFDB:Q383N3	0.807	0.497	1.623E-14	310	0.308	0.184	Q383N3.pdb.gz	Q383N3_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2230 PE=3 SV=1
8	AFDB:P40359	0.800	0.701	1.700E-13	213	0.270	0.235	P40359.pdb.gz	PSF2_YEAST DNA replication complex GINS protein PSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF2 PE=1 SV=1
9	PDB:6sklB	0.810	0.779	2.111E-13	193	0.254	0.244	6sklB.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
10	AFDB:Q9UXG0	0.601	0.574	1.648E-6	196	0.135	0.128	Q9UXG0.pdb.gz	Q9UXG0_SACSO Uncharacterized protein ORF-c40_009 OS=Saccharolobus solfataricus OX=2287 GN=ORF-c40_009 PE=1 SV=1
11	AFDB:Q6NNH6	0.562	0.562	6.360E-6	185	0.189	0.189	Q6NNH6.pdb.gz	Q6NNH6_ARATH At1g19080 OS=Arabidopsis thaliana OX=3702 GN=TTN10 PE=1 SV=1
12	AFDB:Q7ZT01	0.646	0.577	3.104E-5	210	0.178	0.157	Q7ZT01.pdb.gz	PSF3_XENLA DNA replication complex GINS protein PSF3 OS=Xenopus laevis OX=8355 GN=gins3 PE=1 SV=1
13	AFDB:Q583F3	0.617	0.638	3.926E-5	178	0.162	0.169	Q583F3.pdb.gz	Q583F3_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.250 PE=3 SV=1
14	PDB:6xtxC	0.621	0.597	1.176E-4	194	0.173	0.165	6xtxC.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
15	PDB:6sklC	0.449	0.466	8.657E-4	177	0.151	0.158	6sklC.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
16	PDB:6nhj1	0.152	0.117	3.070E-1	257	0.141	0.101	6nhj1.pdb.gz
17	PDB:3vprA	0.206	0.202	8.331E-1	189	0.086	0.085	3vprA.pdb.gz
18	PDB:6wgg7	0.149	0.071	9.935E-1	641	0.065	0.019	6wgg7.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
19	PDB:6xtxD	0.430	0.396	1.117	203	0.097	0.089	6xtxD.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
20	PDB:1zt2A	0.212	0.129	1.185	327	0.054	0.031	1zt2A.pdb.gz	Structure of the heterodimeric core primase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y248	1.88e-137	382	185	1.000	1.000	PSF2_HUMAN DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1
2	Q7ZT46	1.39e-119	337	185	0.859	0.859	PSF2_XENLA DNA replication complex GINS protein PSF2 OS=Xenopus laevis OX=8355 GN=gins2 PE=1 SV=1
3	Q9VQY9	1.86e-53	171	203	0.411	0.374	PSF2_DROME Probable DNA replication complex GINS protein PSF2 OS=Drosophila melanogaster OX=7227 GN=Psf2 PE=1 SV=1
4	O94329	1.79e-30	111	183	0.319	0.322	PSF2_SCHPO DNA replication complex GINS protein psf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf2 PE=1 SV=1
5	Q383N3	7.03e-19	84.0	310	0.243	0.145	Q383N3_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2230 PE=3 SV=1
6	P40359	1.15e-13	68.6	213	0.265	0.230	PSF2_YEAST DNA replication complex GINS protein PSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF2 PE=1 SV=1
7	Q19019	0.59	33.1	582	0.141	0.045	Q19019_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
8	Q95ZR5	0.66	32.7	565	0.141	0.046	Q95ZR5_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
9	Q8BLY7	5.1	30.0	805	0.081	0.019	HPS6_MOUSE BLOC-2 complex member HPS6 OS=Mus musculus OX=10090 GN=Hps6 PE=1 SV=3
10	Q6F9G0	5.7	30.0	483	0.119	0.046	TGNE_ACIAD Succinate semialdehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnE PE=1 SV=1
11	Q58FB8	6.6	30.0	1068	0.141	0.024	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
12	Q5RIL6	6.7	30.0	1068	0.141	0.024	Q5RIL6_DANRE LATS, large tumor suppressor, homolog 1 (Drosophila) OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05916 Sld5	8.1e-20	82.7	GINS complex protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216122	0.999	DNA replication licensing factor MCM5
2	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
3	9606.ENSP00000262460	0.999	DNA replication complex GINS protein PSF1
4	9606.ENSP00000264156	0.999	DNA replication licensing factor MCM6
5	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
6	9606.ENSP00000276533	0.999	DNA replication complex GINS protein SLD5
7	9606.ENSP00000307288	0.999	DNA replication licensing factor MCM7
8	9606.ENSP00000353793	0.999	WD repeat and HMG-box DNA-binding protein 1
9	9606.ENSP00000401018	0.999	GINS complex subunit 3
10	9606.ENSP00000405726	0.999	Cell division control protein 45 homolog
11	9606.ENSP00000480987	0.999	DNA replication licensing factor MCM3
12	9606.ENSP00000216367	0.991	DNA polymerase epsilon subunit 2
13	9606.ENSP00000418268	0.981	Protein MCM10 homolog
14	9606.ENSP00000209728	0.977	Cell division control protein 6 homolog
15	9606.ENSP00000265465	0.964	DNA polymerase alpha subunit B
16	9606.ENSP00000450607	0.964	Protein timeless homolog
17	9606.ENSP00000251496	0.955	Condensin complex subunit 3
18	9606.ENSP00000261881	0.949	TIMELESS-interacting protein
19	9606.ENSP00000376272	0.942	Replication factor C subunit 4
20	9606.ENSP00000378699	0.941	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:0051338	0.949	regulation of transferase activity
GO:0044093	0.941	positive regulation of molecular function
GO:0071840	0.932	cellular component organization or biogenesis
GO:0006259	0.923	DNA metabolic process
GO:0090329	0.918	regulation of DNA-templated DNA replication
GO:0016043	0.917	cellular component organization
GO:0010556	0.915	regulation of macromolecule biosynthetic process
GO:0031326	0.903	regulation of cellular biosynthetic process
GO:0006996	0.880	organelle organization
GO:0051276	0.870	chromosome organization
GO:0048522	0.869	positive regulation of cellular process
GO:0051347	0.863	positive regulation of transferase activity
GO:2001141	0.855	regulation of RNA biosynthetic process
GO:0006261	0.839	DNA-templated DNA replication
GO:0071103	0.805	DNA conformation change
GO:0051054	0.793	positive regulation of DNA metabolic process
GO:0032508	0.741	DNA duplex unwinding
GO:0006268	0.711	DNA unwinding involved in DNA replication
GO:2000278	0.689	regulation of DNA biosynthetic process
GO:2000573	0.672	positive regulation of DNA biosynthetic process
GO:0051254	0.307	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071162	0.995	CMG complex
GO:0000811	0.995	GINS complex
GO:0005829	0.945	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]