StarFunc result for job id Q9Y258

User Input

>input (94 residues)
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y258	1.000	1.000	2.596E-18	94	1.000	1.000	Q9Y258.pdb.gz	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
2	PDB:1g2sA	0.599	0.771	4.413E-11	71	0.755	1.000	1g2sA.pdb.gz
3	AFDB:D3ZQG2	0.633	0.633	2.565E-10	94	0.479	0.479	D3ZQG2.pdb.gz	D3ZQG2_RAT C-C motif chemokine ligand 26 OS=Rattus norvegicus OX=10116 GN=Ccl26 PE=4 SV=2
4	AFDB:P50231	0.618	0.631	1.001E-9	92	0.362	0.370	P50231.pdb.gz	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
5	AFDB:P13501	0.718	0.739	1.575E-9	91	0.362	0.374	P13501.pdb.gz	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
6	AFDB:Q16627	0.651	0.658	7.463E-9	93	0.372	0.376	Q16627.pdb.gz	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
7	AFDB:P55774	0.627	0.662	8.496E-9	89	0.351	0.371	P55774.pdb.gz	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
8	AFDB:P14097	0.628	0.641	1.101E-8	92	0.351	0.359	P14097.pdb.gz	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
9	AFDB:P13236	0.623	0.636	1.523E-8	92	0.362	0.370	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
10	AFDB:P50229	0.613	0.626	1.624E-8	92	0.372	0.380	P50229.pdb.gz	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
11	AFDB:P16619	0.625	0.631	1.733E-8	93	0.372	0.376	P16619.pdb.gz	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
12	PDB:2q8tB	0.611	0.880	5.328E-7	65	0.266	0.385	2q8tB.pdb.gz
13	PDB:2ra4B	0.605	0.868	5.684E-7	65	0.287	0.415	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
14	PDB:5yamA	0.569	0.754	6.905E-7	69	0.330	0.449	5yamA.pdb.gz
15	PDB:1esrA	0.586	0.719	8.387E-7	76	0.245	0.303	1esrA.pdb.gz
16	PDB:4zltF	0.591	0.883	8.387E-7	62	0.266	0.403	4zltF.pdb.gz
17	PDB:4mheA	0.590	0.789	1.019E-6	69	0.309	0.420	4mheA.pdb.gz
18	PDB:7f1tA	0.603	0.136	1.948E-6	423	0.277	0.061	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
19	PDB:5ltlB	0.537	0.734	5.495E-6	68	0.266	0.368	5ltlB.pdb.gz
20	PDB:1bo0A	0.617	0.749	7.598E-6	76	0.287	0.355	1bo0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y258	2.86e-65	193	94	1.000	1.000	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
2	D3ZQG2	1.19e-25	94.7	150	0.489	0.307	D3ZQG2_RAT C-C motif chemokine ligand 26 OS=Rattus norvegicus OX=10116 GN=Ccl26 PE=4 SV=2
3	Q8NHW4	2.15e-18	74.7	92	0.394	0.402	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
4	P16619	3.41e-18	74.3	93	0.394	0.398	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
5	P10147	4.92e-18	73.9	92	0.372	0.380	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
6	P50231	7.62e-18	73.2	92	0.362	0.370	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
7	P13236	2.73e-17	72.0	92	0.383	0.391	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
8	P30882	5.71e-17	70.9	91	0.362	0.374	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
9	P13501	9.50e-16	67.8	91	0.298	0.308	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
10	Q16627	1.90e-15	67.4	93	0.383	0.387	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
11	P50230	3.48e-15	66.6	92	0.330	0.337	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
12	P50229	4.28e-15	66.2	92	0.351	0.359	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
13	P10855	4.78e-15	66.2	92	0.372	0.380	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
14	P14097	9.69e-15	65.5	92	0.309	0.315	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
15	Q99616	1.31e-14	65.1	98	0.277	0.265	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
16	P55774	2.56e-14	64.3	89	0.362	0.382	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
17	Q92583	7.23e-13	60.8	94	0.287	0.287	CCL17_HUMAN C-C motif chemokine 17 OS=Homo sapiens OX=9606 GN=CCL17 PE=1 SV=1
18	Q4KS30	9.16e-13	60.5	89	0.340	0.360	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
19	P48298	2.06e-12	59.7	97	0.372	0.361	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
20	Q9I8E0	3.56e-12	58.9	89	0.330	0.348	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18626 Gln_deamidase_2	70	15.0	Glutaminase
2	PF00048 IL8	1.8e-17	74.5	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378365

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441600	0.997	C-C chemokine receptor type 3
2	9606.ENSP00000351059	0.840	CX3C chemokine receptor 1
3	9606.ENSP00000296140	0.828	C-C chemokine receptor type 1
4	9606.ENSP00000292301	0.812	C-C chemokine receptor type 2
5	9606.ENSP00000326432	0.746	C-C chemokine receptor type 8
6	9606.ENSP00000292303	0.722	C-C chemokine receptor type 5
7	9606.ENSP00000319635	0.722	C-X-C chemokine receptor type 2
8	9606.ENSP00000295683	0.720	C-X-C chemokine receptor type 1
9	9606.ENSP00000304915	0.720	Interleukin-13
10	9606.ENSP00000362795	0.718	C-X-C chemokine receptor type 3
11	9606.ENSP00000231454	0.705	Interleukin-5
12	9606.ENSP00000343952	0.705	Chemokine (C-C motif) receptor 6
13	9606.ENSP00000305651	0.702	C-X-C motif chemokine 10
14	9606.ENSP00000386884	0.691	C-X-C chemokine receptor type 4
15	9606.ENSP00000225831	0.683	C-C motif chemokine 2
16	9606.ENSP00000310405	0.683	Chemokine XC receptor 1
17	9606.ENSP00000332504	0.683	C-C chemokine receptor type 10
18	9606.ENSP00000350256	0.683	C-C chemokine receptor type 9
19	9606.ENSP00000339804	0.681	Thymic stromal lymphopoietin
20	9606.ENSP00000385247	0.681	Calpain-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.999	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042221	0.987	response to chemical
GO:0009987	0.985	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0051716	0.980	cellular response to stimulus
GO:0006935	0.980	chemotaxis
GO:0048518	0.975	positive regulation of biological process
GO:0002376	0.970	immune system process
GO:0048522	0.969	positive regulation of cellular process
GO:0007154	0.948	cell communication
GO:0070887	0.947	cellular response to chemical stimulus
GO:0040017	0.944	positive regulation of locomotion
GO:0060326	0.938	cell chemotaxis
GO:0050900	0.924	leukocyte migration
GO:0030595	0.909	leukocyte chemotaxis
GO:0023052	0.902	signaling
GO:0032103	0.897	positive regulation of response to external stimulus
GO:0030335	0.896	positive regulation of cell migration
GO:0034097	0.883	response to cytokine
GO:0050921	0.836	positive regulation of chemotaxis
GO:0031334	0.792	positive regulation of protein-containing complex assembly
GO:0065008	0.783	regulation of biological quality
GO:0006950	0.782	response to stress
GO:0007165	0.764	signal transduction
GO:0097529	0.727	myeloid leukocyte migration
GO:0032273	0.727	positive regulation of protein polymerization
GO:0030833	0.726	regulation of actin filament polymerization
GO:0042127	0.709	regulation of cell population proliferation
GO:0051495	0.701	positive regulation of cytoskeleton organization
GO:0071310	0.680	cellular response to organic substance
GO:0006952	0.676	defense response
GO:0044093	0.643	positive regulation of molecular function
GO:0030838	0.635	positive regulation of actin filament polymerization
GO:0071345	0.593	cellular response to cytokine stimulus
GO:0008284	0.529	positive regulation of cell population proliferation
GO:0071674	0.506	mononuclear cell migration
GO:0006955	0.480	immune response
GO:0006954	0.458	inflammatory response
GO:0032501	0.449	multicellular organismal process
GO:0002684	0.438	positive regulation of immune system process
GO:0051345	0.426	positive regulation of hydrolase activity
GO:0050678	0.389	regulation of epithelial cell proliferation
GO:0007267	0.385	cell-cell signaling
GO:0051239	0.383	regulation of multicellular organismal process
GO:0019222	0.369	regulation of metabolic process
GO:0051707	0.345	response to other organism
GO:0002685	0.333	regulation of leukocyte migration
GO:0032502	0.332	developmental process
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0048519	0.323	negative regulation of biological process
GO:0048856	0.322	anatomical structure development
GO:0007166	0.302	cell surface receptor signaling pathway
GO:0001936	0.300	regulation of endothelial cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.492	cell periphery
GO:0016020	0.385	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]