StarFunc result for job id Q9Y261

User Input

>input (457 residues)
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG
TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP
EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0ZTD4	0.300	0.296	3.480E-68	463	1.000	0.987	B0ZTD4.pdb.gz	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
2	AFDB:Q6P0C9	0.281	0.298	7.944E-35	427	0.536	0.574	Q6P0C9.pdb.gz	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
3	AFDB:O73783	0.256	0.273	2.679E-33	424	0.525	0.566	O73783.pdb.gz
4	AFDB:P33205	0.242	0.276	4.402E-29	399	0.400	0.459	P33205.pdb.gz	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
5	AFDB:O73843	0.244	0.340	3.857E-26	324	0.365	0.515	O73843.pdb.gz	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
6	AFDB:Q9DE25	0.234	0.224	1.509E-19	476	0.269	0.258	Q9DE25.pdb.gz	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
7	AFDB:Q64731	0.216	0.292	1.835E-19	336	0.258	0.351	Q64731.pdb.gz	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
8	AFDB:O93529	0.244	0.344	1.383E-18	319	0.239	0.342	O93529.pdb.gz	FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis OX=8355 GN=foxb1 PE=2 SV=1
9	AFDB:Q13461	0.231	0.327	5.431E-18	319	0.243	0.348	Q13461.pdb.gz	FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens OX=9606 GN=FOXE3 PE=1 SV=2
10	AFDB:Q9NU39	0.234	0.261	1.267E-17	408	0.245	0.275	Q9NU39.pdb.gz	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
11	PDB:2hdcA	0.182	0.685	9.862E-10	97	0.136	0.639	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:3euhB	0.159	0.218	3.103E-2	321	0.024	0.034	3euhB.pdb.gz
13	PDB:5k1yD	0.124	0.490	4.588E-2	92	0.028	0.141	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
14	PDB:6jmiA	0.126	0.422	5.953E-2	100	0.028	0.130	6jmiA.pdb.gz
15	PDB:7k5yU	0.134	0.626	6.782E-2	75	0.035	0.213	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
16	PDB:2qbyB	0.132	0.158	7.238E-2	368	0.037	0.046	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
17	PDB:4yrvA	0.102	0.155	7.726E-2	288	0.042	0.066	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
18	PDB:6i6mB	0.127	0.157	1.003E-1	357	0.031	0.039	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
19	PDB:2nyxB	0.119	0.323	1.070E-1	147	0.026	0.082	2nyxB.pdb.gz
20	PDB:4etsB	0.132	0.352	1.070E-1	149	0.039	0.121	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0ZTD4	0.0	924	463	1.000	0.987	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
2	P32182	0.0	879	458	0.963	0.961	FOXA2_RAT Hepatocyte nuclear factor 3-beta OS=Rattus norvegicus OX=10116 GN=Foxa2 PE=1 SV=1
3	P35583	0.0	894	459	0.976	0.972	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
4	Q07342	0.0	526	409	0.650	0.726	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
5	Q91765	0.0	604	434	0.720	0.758	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
6	Q9Y261	0.0	923	457	1.000	1.000	FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens OX=9606 GN=FOXA2 PE=1 SV=1
7	P55317	2.59e-141	415	472	0.586	0.568	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2
8	P35582	2.27e-132	392	468	0.549	0.536	FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus OX=10090 GN=Foxa1 PE=1 SV=2
9	P23512	1.22e-130	387	466	0.551	0.541	FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus OX=10116 GN=Foxa1 PE=1 SV=1
10	Q6P0C9	9.52e-129	381	427	0.538	0.576	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
11	O73778	3.31e-104	319	441	0.466	0.483	O73778_DANRE Fork head domain protein FKD2 OS=Danio rerio OX=7955 GN=fkd2 PE=2 SV=1
12	P33205	1.20e-95	295	399	0.414	0.474	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
13	O73843	1.29e-89	277	324	0.363	0.512	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
14	P14734	4.51e-76	248	510	0.276	0.247	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1
15	P32183	7.40e-75	240	354	0.319	0.412	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
16	P35584	1.86e-72	234	353	0.315	0.408	FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus OX=10090 GN=Foxa3 PE=1 SV=1
17	P55318	1.29e-71	232	350	0.313	0.409	FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens OX=9606 GN=FOXA3 PE=1 SV=2
18	Q17381	6.72e-59	203	506	0.186	0.168	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
19	Q99853	1.75e-54	186	325	0.208	0.292	FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens OX=9606 GN=FOXB1 PE=1 SV=3
20	Q64732	1.79e-54	186	325	0.208	0.292	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.3e-34	129.5	Forkhead domain
2	PF08430 Forkhead_N	7.6e-20	83.3	Forkhead N-terminal region
3	PF09354 HNF_C	8.4e-25	98.8	HNF3 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400341

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370421	0.970	Pancreas/duodenum homeobox protein 1
2	9606.ENSP00000451828	0.958	RAC-alpha serine/threonine-protein kinase
3	9606.ENSP00000437955	0.952	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000297316	0.912	Transcription factor SOX-17
5	9606.ENSP00000343819	0.911	Homeobox protein OTX2
6	9606.ENSP00000336528	0.904	Nuclear receptor subfamily 1 group I member 2
7	9606.ENSP00000225577	0.894	Ribosomal protein S6 kinase beta-1
8	9606.ENSP00000334458	0.882	Transcription factor GATA-4
9	9606.ENSP00000308413	0.880	Ribosomal protein S6 kinase beta-2
10	9606.ENSP00000344479	0.867	Nuclear receptor subfamily 4 group A member 2
11	9606.ENSP00000366347	0.852	Homeobox protein Nkx-2.2
12	9606.ENSP00000302630	0.846	Hepatocyte nuclear factor 6
13	9606.ENSP00000363822	0.843	Androgen receptor
14	9606.ENSP00000312987	0.836	Hepatocyte nuclear factor 4-alpha
15	9606.ENSP00000346879	0.833	Homeobox protein Nkx-2.1
16	9606.ENSP00000269216	0.832	Transcription factor GATA-6
17	9606.ENSP00000323588	0.812	Transcription factor SOX-2
18	9606.ENSP00000340226	0.798	LIM homeobox transcription factor 1-alpha
19	9606.ENSP00000379138	0.795	Alpha-fetoprotein
20	9606.ENSP00000404100	0.784	Paired box protein Pax-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.969	protein binding
GO:0000981	0.947	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.735	DNA-binding transcription activator activity
GO:0001228	0.339	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045893	0.995	positive regulation of DNA-templated transcription
GO:0006357	0.992	regulation of transcription by RNA polymerase II
GO:0050896	0.983	response to stimulus
GO:0048856	0.973	anatomical structure development
GO:0009987	0.966	cellular process
GO:0032501	0.958	multicellular organismal process
GO:0045944	0.948	positive regulation of transcription by RNA polymerase II
GO:0007275	0.869	multicellular organism development
GO:0048731	0.816	system development
GO:0048519	0.741	negative regulation of biological process
GO:0048523	0.699	negative regulation of cellular process
GO:0048513	0.631	animal organ development
GO:0009653	0.552	anatomical structure morphogenesis
GO:0051716	0.545	cellular response to stimulus
GO:0048583	0.545	regulation of response to stimulus
GO:0009888	0.539	tissue development
GO:0042221	0.480	response to chemical
GO:0007399	0.463	nervous system development
GO:0010646	0.451	regulation of cell communication
GO:0023051	0.447	regulation of signaling
GO:0009892	0.434	negative regulation of metabolic process
GO:0007154	0.429	cell communication
GO:0010605	0.411	negative regulation of macromolecule metabolic process
GO:0031324	0.403	negative regulation of cellular metabolic process
GO:0051172	0.397	negative regulation of nitrogen compound metabolic process
GO:0023052	0.378	signaling
GO:0009966	0.370	regulation of signal transduction
GO:0007165	0.370	signal transduction
GO:0030154	0.355	cell differentiation
GO:0010033	0.341	response to organic substance
GO:0050793	0.328	regulation of developmental process
GO:0051239	0.314	regulation of multicellular organismal process
GO:0010558	0.306	negative regulation of macromolecule biosynthetic process
GO:0031327	0.306	negative regulation of cellular biosynthetic process
GO:0008152	0.305	metabolic process
GO:0045595	0.302	regulation of cell differentiation
GO:0045892	0.301	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005654	0.962	nucleoplasm
GO:0005737	0.370	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]