StarFunc result for job id Q9Y262

User Input

>input (564 residues)
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFH
KTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAP
QVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPN
QWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNI
NRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELN
KKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMI
NKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKF
LSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLD
LTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYG
DFFIRQIHKFEELNRTLKKMGQRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8QZY1	0.918	0.918	3.813E-71	564	0.991	0.991	Q8QZY1.pdb.gz	EIF3L_MOUSE Eukaryotic translation initiation factor 3 subunit L OS=Mus musculus OX=10090 GN=Eif3l PE=1 SV=1
2	AFDB:Q9VTU4	0.839	0.877	3.332E-45	539	0.527	0.551	Q9VTU4.pdb.gz	EIF3L_DROME Eukaryotic translation initiation factor 3 subunit L OS=Drosophila melanogaster OX=7227 GN=eIF3l PE=2 SV=1
3	AFDB:F4JY76	0.770	0.842	2.338E-36	514	0.415	0.455	F4JY76.pdb.gz	F4JY76_ARATH Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 GN=At5g25754 PE=1 SV=1
4	PDB:6fec7	0.307	0.424	1.135E-24	372	0.647	0.981	6fec7.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
5	PDB:6ybd5	0.248	0.391	4.063E-20	319	0.553	0.978	6ybd5.pdb.gz
6	AFDB:Q38BD7	0.669	0.765	2.391E-18	488	0.202	0.234	Q38BD7.pdb.gz	Q38BD7_TRYB2 Eukaryotic translation initiation factor 3 subunit L OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2570 PE=3 SV=1
7	AFDB:Q4Q253	0.698	0.627	2.964E-18	633	0.209	0.186	Q4Q253.pdb.gz	Q4Q253_LEIMA Eukaryotic translation initiation factor 3 subunit L OS=Leishmania major OX=5664 GN=LMJF_36_0250 PE=3 SV=1
8	AFDB:Q38AD5	0.253	0.210	6.878E-7	740	0.145	0.111	Q38AD5.pdb.gz	Q38AD5_TRYB2 Eukaryotic translation initiation factor 3 subunit 8, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2220 PE=4 SV=1
9	PDB:6zp4C	0.281	0.260	2.309E-6	633	0.126	0.112	6zp4C.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
10	AFDB:O43242	0.345	0.361	5.411E-6	534	0.140	0.148	O43242.pdb.gz	PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2
11	AFDB:P32497	0.269	0.208	6.426E-6	812	0.160	0.111	P32497.pdb.gz	EIF3C_YEAST Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIP1 PE=1 SV=2
12	AFDB:Q6NYV1	0.373	0.407	9.876E-6	503	0.122	0.137	Q6NYV1.pdb.gz	Q6NYV1_DANRE 26S proteasome non-ATPase regulatory subunit 3 OS=Danio rerio OX=7955 GN=zgc:65867 PE=1 SV=1
13	AFDB:P25161	0.385	0.426	1.173E-5	494	0.140	0.160	P25161.pdb.gz	PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster OX=7227 GN=Rpn3 PE=2 SV=1
14	PDB:7qp7y	0.260	0.238	2.350E-5	642	0.126	0.111	7qp7y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
15	PDB:5mpbP	0.264	0.323	4.109E-5	440	0.108	0.139	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:7qp6y	0.288	0.246	8.173E-5	697	0.105	0.085	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
17	PDB:6zceq	0.267	0.248	1.013E-4	636	0.144	0.127	6zceq.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	PDB:5l4kP	0.253	0.297	1.153E-4	456	0.126	0.156	5l4kP.pdb.gz
19	PDB:5mpbQ	0.198	0.233	4.367E-4	434	0.090	0.118	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:5gjqP	0.284	0.367	5.652E-4	413	0.117	0.160	5gjqP.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8QZY1	0.0	1167	564	0.991	0.991	EIF3L_MOUSE Eukaryotic translation initiation factor 3 subunit L OS=Mus musculus OX=10090 GN=Eif3l PE=1 SV=1
2	Q9VTU4	0.0	601	539	0.530	0.555	EIF3L_DROME Eukaryotic translation initiation factor 3 subunit L OS=Drosophila melanogaster OX=7227 GN=eIF3l PE=2 SV=1
3	Q9Y262	0.0	1174	564	1.000	1.000	EIF3L_HUMAN Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1
4	F4JY76	2.09e-146	433	514	0.408	0.447	F4JY76_ARATH Eukaryotic translation initiation factor 3 subunit L OS=Arabidopsis thaliana OX=3702 GN=At5g25754 PE=1 SV=1
5	Q38BD7	2.59e-29	123	488	0.213	0.246	Q38BD7_TRYB2 Eukaryotic translation initiation factor 3 subunit L OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2570 PE=3 SV=1
6	Q4Q253	2.06e-28	122	633	0.202	0.180	Q4Q253_LEIMA Eukaryotic translation initiation factor 3 subunit L OS=Leishmania major OX=5664 GN=LMJF_36_0250 PE=3 SV=1
7	Q23049	0.15	37.4	506	0.035	0.040	TTC8_CAEEL Tetratricopeptide repeat protein 8 OS=Caenorhabditis elegans OX=6239 GN=bbs-8 PE=2 SV=2
8	Q9D0T7	3.3	32.3	191	0.032	0.094	GKN3_MOUSE Gastrokine-3 OS=Mus musculus OX=10090 GN=Gkn3 PE=1 SV=1
9	Q92791	3.4	32.7	437	0.083	0.108	SC65_HUMAN Endoplasmic reticulum protein SC65 OS=Homo sapiens OX=9606 GN=P3H4 PE=1 SV=1
10	A0A0H2UQR2	3.9	32.7	403	0.041	0.057	A0A0H2UQR2_STRPN TPR domain protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1504 PE=1 SV=1
11	O59778	4.5	32.3	363	0.043	0.066	BIOB_SCHPO Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bio2 PE=1 SV=1
12	Q9GS00	8.2	31.6	601	0.037	0.035	CSN1_CAEEL COP9 signalosome complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=csn-1 PE=1 SV=1
13	Q8K2B0	8.3	31.6	443	0.082	0.104	SC65_MOUSE Endoplasmic reticulum protein SC65 OS=Mus musculus OX=10090 GN=P3h4 PE=1 SV=1
14	M9PGU7	9.6	31.6	2066	0.030	0.008	M9PGU7_DROME X11Lbeta, isoform D OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=2
15	X2JB44	9.9	31.6	2129	0.030	0.008	X2JB44_DROME X11Lbeta, isoform E OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.3e+02	14.3	Anaphase-promoting complex, cyclosome, subunit 3
2	PF20285 CTD9	7.5e+02	12.1	C-terminal domain 9 of the ABC-three component (ABC-3C) systems
3	PF10255 Paf67	1.8e-174	592.2	RNA polymerase I-associated factor PAF67
4	PF00515 TPR_1	53	15.1	Tetratricopeptide repeat
5	PF07719 TPR_2	9.5	17.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000009526

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000000403	0.999	Eukaryotic translation initiation factor 3, subunit E
2	132908.ENSPVAP00000001903	0.999	Eukaryotic translation initiation factor 3, subunit D
3	132908.ENSPVAP00000002514	0.999	Eukaryotic translation initiation factor 3, subunit H
4	132908.ENSPVAP00000002970	0.999	Eukaryotic translation initiation factor 3, subunit A
5	132908.ENSPVAP00000003473	0.999	Eukaryotic translation initiation factor 3, subunit G
6	132908.ENSPVAP00000005488	0.999	annotation not available
7	132908.ENSPVAP00000012163	0.999	Eukaryotic translation initiation factor 3, subunit K
8	132908.ENSPVAP00000012560	0.999	Eukaryotic translation initiation factor 3, subunit I
9	132908.ENSPVAP00000012954	0.999	Eukaryotic translation initiation factor 3, subunit B
10	132908.ENSPVAP00000014217	0.999	Eukaryotic translation initiation factor 3, subunit M
11	132908.ENSPVAP00000014870	0.999	Eukaryotic translation initiation factor 3, subunit F
12	132908.ENSPVAP00000013358	0.998	Eukaryotic translation initiation factor 3, subunit J
13	132908.ENSPVAP00000007469	0.957	Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
14	132908.ENSPVAP00000010626	0.942	Ribosomal protein S3
15	132908.ENSPVAP00000012149	0.927	Ribosomal protein S4, X-linked
16	132908.ENSPVAP00000011776	0.916	Ribosomal protein S25
17	132908.ENSPVAP00000012423	0.905	ATP-binding cassette, sub-family E (OABP), member 1
18	132908.ENSPVAP00000013168	0.904	Ribosomal protein S5
19	132908.ENSPVAP00000002871	0.900	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
20	132908.ENSPVAP00000012076	0.899	Ribosomal protein S13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.868	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0006412	0.983	translation
GO:0006413	0.866	translational initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.995	cytosol
GO:0016020	0.991	membrane
GO:0070013	0.983	intracellular organelle lumen
GO:0031981	0.970	nuclear lumen
GO:0005852	0.969	eukaryotic translation initiation factor 3 complex
GO:0043232	0.935	intracellular non-membrane-bounded organelle
GO:0005654	0.935	nucleoplasm
GO:0030054	0.587	cell junction
GO:0005730	0.521	nucleolus
GO:0031982	0.475	vesicle
GO:0005576	0.460	extracellular region
GO:0045202	0.326	synapse
GO:0012505	0.300	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]