StarFunc result for job id Q9Y264

User Input

>input (503 residues)
MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPE
VSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQ
QQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQ
LLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERG
LRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGAS
ASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEH
WLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIR
WHYFKGPSYSLRASRMMIRPLDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y264	1.000	1.000	7.166E-80	503	1.000	1.000	Q9Y264.pdb.gz	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
2	AFDB:O15123	0.542	0.549	1.502E-47	496	0.447	0.454	O15123.pdb.gz	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
3	AFDB:O08538	0.478	0.481	1.967E-46	498	0.447	0.452	O08538.pdb.gz	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
4	AFDB:Q9WVH6	0.607	0.601	6.170E-46	509	0.535	0.528	Q9WVH6.pdb.gz	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
5	AFDB:O35462	0.526	0.532	1.352E-44	496	0.441	0.448	O35462.pdb.gz	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
6	AFDB:O43827	0.411	0.593	6.713E-30	346	0.239	0.347	O43827.pdb.gz	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
7	AFDB:O95841	0.415	0.425	2.500E-29	491	0.264	0.271	O95841.pdb.gz	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
8	AFDB:Q9R045	0.410	0.419	5.564E-29	493	0.252	0.258	Q9R045.pdb.gz	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
9	AFDB:Q71KU9	0.415	0.657	3.466E-28	314	0.207	0.331	Q71KU9.pdb.gz	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
10	AFDB:Q8NI99	0.419	0.448	3.886E-28	470	0.205	0.219	Q8NI99.pdb.gz	ANGL6_HUMAN Angiopoietin-related protein 6 OS=Homo sapiens OX=9606 GN=ANGPTL6 PE=1 SV=1
11	PDB:3ghgB	0.401	0.501	4.557E-26	401	0.197	0.247	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
12	PDB:1m1jB	0.405	0.504	2.014E-25	402	0.225	0.281	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:1jc9A	0.410	0.919	2.391E-25	220	0.175	0.400	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
14	PDB:3ghgI	0.404	0.511	9.821E-24	394	0.203	0.259	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.407	0.512	1.465E-23	397	0.205	0.259	1ei3C.pdb.gz
16	PDB:4wmqA	0.221	0.349	1.730E-5	283	0.089	0.159	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.231	0.366	4.841E-5	281	0.087	0.157	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:7fdeP	0.119	0.261	1.925E-1	181	0.042	0.116	7fdeP.pdb.gz
19	PDB:7ua3A	0.079	0.018	2.286E-1	4443	0.046	0.005	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7u9tA	0.096	0.020	3.042E-1	4229	0.052	0.006	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y264	0.0	1040	503	1.000	1.000	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
2	Q9WVH6	4.21e-168	486	509	0.521	0.515	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
3	Q15389	9.71e-162	469	498	0.449	0.454	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
4	O08538	1.09e-161	469	498	0.447	0.452	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
5	O15123	7.06e-160	465	496	0.445	0.452	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
6	O35460	2.29e-159	463	497	0.443	0.449	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
7	O35608	2.20e-158	461	496	0.445	0.452	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
8	Q90Z19	5.72e-158	461	513	0.453	0.444	Q90Z19_DANRE Angiopoietin-1 OS=Danio rerio OX=7955 GN=ang1 PE=2 SV=1
9	O35462	6.33e-157	457	496	0.461	0.468	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
10	Q90Z18	4.35e-148	434	489	0.435	0.448	Q90Z18_DANRE Angiopoietin-2 OS=Danio rerio OX=7955 GN=ang2 PE=2 SV=1
11	O43827	6.93e-69	226	346	0.241	0.350	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
12	O95841	3.61e-61	210	491	0.195	0.200	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
13	Q5KQU0	9.44e-61	209	480	0.290	0.304	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
14	Q5RH53	1.33e-60	208	480	0.290	0.304	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1
15	Q640P2	5.66e-60	207	490	0.195	0.200	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1
16	Q9R045	2.31e-57	200	493	0.245	0.249	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
17	Q5KQT9	1.60e-55	195	510	0.189	0.186	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
18	B0UXH5	2.02e-55	195	519	0.189	0.183	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
19	Q8NI99	2.65e-55	194	470	0.207	0.221	ANGL6_HUMAN Angiopoietin-related protein 6 OS=Homo sapiens OX=9606 GN=ANGPTL6 PE=1 SV=1
20	Q9UKU9	2.92e-55	194	493	0.243	0.247	ANGL2_HUMAN Angiopoietin-related protein 2 OS=Homo sapiens OX=9606 GN=ANGPTL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11969 DcpS_C	2.2e+02	13.7	Scavenger mRNA decapping enzyme C-term binding
2	PF20332 DUF6627	4.2e+02	12.4	Family of unknown function (DUF6627)
3	PF00147 Fibrinogen_C	6e-67	237.2	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369375	0.993	Angiopoietin-1 receptor
2	9606.ENSP00000361554	0.890	Tyrosine-protein kinase receptor Tie-1
3	9606.ENSP00000314897	0.810	Angiopoietin-2
4	9606.ENSP00000428340	0.810	Angiopoietin-1
5	9606.ENSP00000261937	0.753	Vascular endothelial growth factor receptor 3
6	9606.ENSP00000282397	0.751	Vascular endothelial growth factor receptor 1
7	9606.ENSP00000263923	0.750	Vascular endothelial growth factor receptor 2
8	9606.ENSP00000431418	0.740	High affinity nerve growth factor receptor
9	9606.ENSP00000261799	0.691	Platelet-derived growth factor receptor beta
10	9606.ENSP00000257290	0.679	Platelet-derived growth factor receptor alpha
11	9606.ENSP00000393312	0.669	Fibroblast growth factor receptor 1
12	9606.ENSP00000288135	0.667	Mast/stem cell growth factor receptor Kit
13	9606.ENSP00000292408	0.664	Fibroblast growth factor receptor 4
14	9606.ENSP00000279281	0.651	Vacuolar protein sorting-associated protein 51 homolog
15	9606.ENSP00000286301	0.650	Macrophage colony-stimulating factor 1 receptor
16	9606.ENSP00000351209	0.648	Ephrin type-A receptor 2
17	9606.ENSP00000410294	0.646	Fibroblast growth factor receptor 2
18	9606.ENSP00000339824	0.645	Fibroblast growth factor receptor 3
19	9606.ENSP00000241453	0.643	Receptor-type tyrosine-protein kinase FLT3
20	9606.ENSP00000317272	0.640	Hepatocyte growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0019207	0.996	kinase regulator activity
GO:0019899	0.959	enzyme binding
GO:0140677	0.943	molecular function activator activity
GO:0019901	0.897	protein kinase binding
GO:1990782	0.876	protein tyrosine kinase binding
GO:0030295	0.875	protein kinase activator activity
GO:0030971	0.871	receptor tyrosine kinase binding
GO:0030296	0.853	protein tyrosine kinase activator activity
GO:0003824	0.788	catalytic activity
GO:0005172	0.772	vascular endothelial growth factor receptor binding
GO:0042802	0.679	identical protein binding
GO:0030545	0.666	signaling receptor regulator activity
GO:0030546	0.621	signaling receptor activator activity
GO:0030297	0.611	transmembrane receptor protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0048519	0.979	negative regulation of biological process
GO:0051239	0.976	regulation of multicellular organismal process
GO:0051716	0.974	cellular response to stimulus
GO:0048856	0.972	anatomical structure development
GO:0019222	0.966	regulation of metabolic process
GO:0048518	0.952	positive regulation of biological process
GO:0040012	0.948	regulation of locomotion
GO:0030334	0.935	regulation of cell migration
GO:0010594	0.918	regulation of endothelial cell migration
GO:0031323	0.914	regulation of cellular metabolic process
GO:0048522	0.910	positive regulation of cellular process
GO:0007154	0.907	cell communication
GO:0051174	0.904	regulation of phosphorus metabolic process
GO:0007165	0.902	signal transduction
GO:0048523	0.893	negative regulation of cellular process
GO:0080090	0.885	regulation of primary metabolic process
GO:0007166	0.885	cell surface receptor signaling pathway
GO:0042327	0.880	positive regulation of phosphorylation
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0010604	0.870	positive regulation of macromolecule metabolic process
GO:0007169	0.869	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1901342	0.863	regulation of vasculature development
GO:0051247	0.860	positive regulation of protein metabolic process
GO:0022603	0.834	regulation of anatomical structure morphogenesis
GO:0001932	0.832	regulation of protein phosphorylation
GO:0065009	0.831	regulation of molecular function
GO:0031401	0.828	positive regulation of protein modification process
GO:0048583	0.822	regulation of response to stimulus
GO:0001934	0.802	positive regulation of protein phosphorylation
GO:0045765	0.797	regulation of angiogenesis
GO:0032501	0.795	multicellular organismal process
GO:0030335	0.786	positive regulation of cell migration
GO:0043535	0.759	regulation of blood vessel endothelial cell migration
GO:0050730	0.751	regulation of peptidyl-tyrosine phosphorylation
GO:0042127	0.731	regulation of cell population proliferation
GO:0048584	0.731	positive regulation of response to stimulus
GO:0050790	0.715	regulation of catalytic activity
GO:0009966	0.713	regulation of signal transduction
GO:0010941	0.685	regulation of cell death
GO:0006950	0.679	response to stress
GO:0010595	0.663	positive regulation of endothelial cell migration
GO:0043067	0.648	regulation of programmed cell death
GO:0007275	0.647	multicellular organism development
GO:0008284	0.640	positive regulation of cell population proliferation
GO:0008152	0.638	metabolic process
GO:0071704	0.633	organic substance metabolic process
GO:0042981	0.629	regulation of apoptotic process
GO:0051240	0.589	positive regulation of multicellular organismal process
GO:0048731	0.588	system development
GO:0070482	0.565	response to oxygen levels
GO:0051094	0.558	positive regulation of developmental process
GO:0042221	0.531	response to chemical
GO:0009967	0.527	positive regulation of signal transduction
GO:0043170	0.526	macromolecule metabolic process
GO:0060548	0.513	negative regulation of cell death
GO:0050731	0.509	positive regulation of peptidyl-tyrosine phosphorylation
GO:0050678	0.508	regulation of epithelial cell proliferation
GO:0070887	0.503	cellular response to chemical stimulus
GO:0045766	0.487	positive regulation of angiogenesis
GO:0044093	0.479	positive regulation of molecular function
GO:0043069	0.477	negative regulation of programmed cell death
GO:0043085	0.474	positive regulation of catalytic activity
GO:0043066	0.449	negative regulation of apoptotic process
GO:0006807	0.438	nitrogen compound metabolic process
GO:1902531	0.434	regulation of intracellular signal transduction
GO:0044238	0.433	primary metabolic process
GO:0036293	0.406	response to decreased oxygen levels
GO:0051241	0.387	negative regulation of multicellular organismal process
GO:1901564	0.380	organonitrogen compound metabolic process
GO:0010468	0.357	regulation of gene expression
GO:0044237	0.356	cellular metabolic process
GO:1902533	0.349	positive regulation of intracellular signal transduction
GO:0043549	0.320	regulation of kinase activity
GO:0043408	0.318	regulation of MAPK cascade
GO:0009653	0.312	anatomical structure morphogenesis
GO:0043410	0.311	positive regulation of MAPK cascade
GO:0051336	0.307	regulation of hydrolase activity
GO:0033674	0.306	positive regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043226	0.851	organelle
GO:0043231	0.788	intracellular membrane-bounded organelle
GO:0005737	0.715	cytoplasm
GO:0071944	0.330	cell periphery
GO:0005886	0.311	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]