StarFunc result for job id Q9Y274

User Input

>input (331 residues)
MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQF
HPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVV
VGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDP
NTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
LLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSL
MNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y274	1.000	1.000	1.688E-76	331	1.000	1.000	Q9Y274.pdb.gz	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
2	AFDB:P61131	0.769	0.765	1.197E-32	333	0.369	0.366	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
3	AFDB:Q11203	0.781	0.693	2.541E-30	375	0.344	0.304	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
4	AFDB:Q9UNP4	0.769	0.616	1.027E-28	418	0.305	0.242	Q9UNP4.pdb.gz	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
5	AFDB:A0JMC3	0.770	0.704	5.029E-27	364	0.311	0.283	A0JMC3.pdb.gz	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
6	AFDB:Q6EV30	0.679	0.590	1.220E-25	383	0.314	0.272	Q6EV30.pdb.gz
7	AFDB:Q11201	0.637	0.621	7.097E-21	340	0.239	0.232	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
8	AFDB:Q02745	0.642	0.621	1.526E-20	343	0.242	0.233	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
9	AFDB:Q11204	0.680	0.645	1.102E-19	350	0.215	0.203	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
10	AFDB:P54751	0.628	0.618	1.422E-19	337	0.248	0.243	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
11	PDB:6aplC	0.690	0.740	5.248E-17	306	0.193	0.209	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:1oc4A	0.122	0.126	3.033E-1	315	0.063	0.067	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
13	PDB:1x3lA	0.154	0.129	3.446E-1	436	0.112	0.085	1x3lA.pdb.gz
14	PDB:3rf6B	0.138	0.133	3.446E-1	352	0.115	0.108	3rf6B.pdb.gz	Crystal structure of glycerol-3 phosphate bound HAD-like phosphatase from Saccharomyces cerevisiae
15	PDB:4r1uB	0.169	0.177	3.446E-1	309	0.100	0.107	4r1uB.pdb.gz
16	PDB:7epmA	0.123	0.123	3.673E-1	335	0.051	0.051	7epmA.pdb.gz	Identification of human LDHC4 as a potential target for anticancer drug discovery.
17	PDB:7miiA	0.121	0.097	4.172E-1	497	0.082	0.054	7miiA.pdb.gz	Structural basis for isoform-specific inhibition of human CTPS1.
18	PDB:5zfsB	0.129	0.137	5.740E-1	294	0.079	0.088	5zfsB.pdb.gz	X-ray structure of Arthrobacter globiformis M30 ketose 3-epimerase for the production of D-allulose from D-fructose.
19	PDB:3lrpA	0.122	0.176	6.521E-1	181	0.079	0.144	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
20	PDB:4c4aA	0.089	0.057	6.950E-1	641	0.039	0.020	4c4aA.pdb.gz	Structural Insight Into Arginine Methylation by the Mouse Protein Arginine Methyltransferase 7: A Zinc Finger Freezes the Mimic of the Dimeric State Into a Single Active Site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y274	0.0	689	331	1.000	1.000	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
2	Q11206	1.39e-63	206	333	0.356	0.354	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
3	Q91Y74	8.47e-63	204	333	0.329	0.327	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
4	P61131	2.33e-62	203	333	0.332	0.330	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
5	Q11203	5.29e-61	201	375	0.299	0.264	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
6	P97325	3.54e-60	199	374	0.296	0.262	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
7	Q02734	1.33e-59	197	374	0.296	0.262	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
8	Q08BF4	6.06e-49	170	382	0.278	0.241	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
9	Q9UNP4	2.56e-48	169	418	0.308	0.244	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
10	F1RCA6	3.83e-38	141	364	0.263	0.239	F1RCA6_DANRE Lactosylceramide alpha-2,3-sialyltransferase isoform X1 OS=Danio rerio OX=7955 GN=st3Gal-V PE=3 SV=1
11	A0JMC3	4.17e-38	140	364	0.263	0.239	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
12	Q11201	2.57e-22	97.8	340	0.211	0.206	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
13	P54751	2.84e-22	97.4	337	0.196	0.193	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
14	Q02745	2.64e-21	95.1	343	0.190	0.184	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
15	Q11205	2.82e-21	95.1	350	0.190	0.180	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
16	Q11204	6.78e-21	94.0	350	0.169	0.160	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
17	Q16842	6.35e-20	91.3	350	0.175	0.166	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
18	Q96JF0	5.40e-16	80.9	529	0.205	0.129	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
19	Q76K27	1.04e-14	77.0	524	0.202	0.128	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
20	Q8QH83	3.09e-13	72.0	381	0.157	0.136	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	1.4e-56	203.6	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000008822

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000017478	0.974	Fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
2	9555.ENSPANP00000003644	0.969	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
3	9555.ENSPANP00000010099	0.966	L-Fucosyltransferase
4	9555.ENSPANP00000004070	0.964	Fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
5	9555.ENSPANP00000006830	0.964	UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
6	9555.ENSPANP00000000416	0.962	Fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
7	9555.ENSPANP00000019154	0.962	UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
8	9555.ENSPANP00000009084	0.958	Hexosyltransferase
9	9555.ENSPANP00000010584	0.958	L-Fucosyltransferase
10	9555.ENSPANP00000008949	0.955	Beta-1,4-galactosyltransferase 2
11	9555.ENSPANP00000010716	0.954	Beta-1,4-galactosyltransferase 3
12	9555.ENSPANP00000006547	0.950	Hexosyltransferase
13	9555.ENSPANP00000013612	0.945	Glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
14	9555.ENSPANP00000000413	0.843	Fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
15	9555.ENSPANP00000014558	0.794	Glucosaminyl (N-acetyl) transferase family member 7
16	9555.ENSPANP00000011273	0.724	annotation not available
17	9555.ENSPANP00000011341	0.724	annotation not available
18	9555.ENSPANP00000000108	0.688	Glucosaminyl (N-acetyl) transferase 4, core 2
19	9555.ENSPANP00000015716	0.684	Glycosyltransferase 6 domain containing 1
20	9555.ENSPANP00000006520	0.678	Polypeptide N-acetylgalactosaminyltransferase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.820	binding
GO:0005515	0.731	protein binding
GO:0003836	0.710	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:1901135	0.994	carbohydrate derivative metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:1901137	0.982	carbohydrate derivative biosynthetic process
GO:0019538	0.961	protein metabolic process
GO:0043412	0.947	macromolecule modification
GO:0044249	0.936	cellular biosynthetic process
GO:0009311	0.936	oligosaccharide metabolic process
GO:1901566	0.935	organonitrogen compound biosynthetic process
GO:0006643	0.923	membrane lipid metabolic process
GO:0009059	0.921	macromolecule biosynthetic process
GO:0036211	0.917	protein modification process
GO:1903509	0.874	liposaccharide metabolic process
GO:0006664	0.854	glycolipid metabolic process
GO:0016051	0.742	carbohydrate biosynthetic process
GO:0009312	0.649	oligosaccharide biosynthetic process
GO:0009100	0.637	glycoprotein metabolic process
GO:0070085	0.622	glycosylation
GO:0009101	0.621	glycoprotein biosynthetic process
GO:0006486	0.585	protein glycosylation
GO:0030203	0.420	glycosaminoglycan metabolic process
GO:1903510	0.393	mucopolysaccharide metabolic process
GO:0006665	0.387	sphingolipid metabolic process
GO:0006023	0.306	aminoglycan biosynthetic process
GO:0006024	0.300	glycosaminoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.990	extracellular region
GO:0043230	0.980	extracellular organelle
GO:0031982	0.975	vesicle
GO:0005615	0.945	extracellular space
GO:1903561	0.945	extracellular vesicle
GO:0070062	0.897	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:21616	0.710	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.4	0.710	Transferred entry: 2.4.3.4.

[back to server]