StarFunc result for job id Q9Y279

User Input

>input (399 residues)
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y279	1.000	1.000	8.117E-70	399	1.000	1.000	Q9Y279.pdb.gz	VSIG4_HUMAN V-set and immunoglobulin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSIG4 PE=1 SV=1
2	AFDB:F6TUL9	0.335	0.463	1.887E-26	280	0.426	0.607	F6TUL9.pdb.gz	F6TUL9_MOUSE V-set and immunoglobulin domain containing 4 OS=Mus musculus OX=10090 GN=Vsig4 PE=1 SV=1
3	AFDB:F7FEU1	0.374	0.511	1.122E-25	285	0.434	0.607	F7FEU1.pdb.gz	F7FEU1_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
4	AFDB:Q9JLB9	0.293	0.221	1.374E-16	549	0.195	0.142	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
5	AFDB:B0CLV1	0.284	0.268	1.786E-16	428	0.160	0.150	B0CLV1.pdb.gz	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
6	AFDB:K4PZ75	0.265	0.210	7.754E-16	510	0.201	0.157	K4PZ75.pdb.gz	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
7	AFDB:Q15223	0.270	0.211	1.624E-14	517	0.201	0.155	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
8	AFDB:Q99795	0.296	0.364	2.003E-14	319	0.165	0.207	Q99795.pdb.gz	GPA33_HUMAN Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1
9	AFDB:Q8K4F0	0.226	0.267	1.256E-13	333	0.150	0.180	Q8K4F0.pdb.gz	CD226_MOUSE CD226 antigen OS=Mus musculus OX=10090 GN=Cd226 PE=1 SV=1
10	AFDB:Q1WIM2	0.224	0.208	2.121E-13	435	0.170	0.156	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
11	PDB:6dlfA	0.222	0.350	4.285E-11	236	0.105	0.178	6dlfA.pdb.gz
12	PDB:6dldD	0.227	0.320	1.223E-10	269	0.113	0.167	6dldD.pdb.gz
13	PDB:5c6wJ	0.247	0.392	1.166E-9	238	0.085	0.143	5c6wJ.pdb.gz
14	PDB:1ngwH	0.236	0.414	3.897E-9	216	0.110	0.204	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
15	PDB:2qhrL	0.255	0.448	6.617E-8	218	0.090	0.165	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
16	PDB:2jb5L	0.235	0.421	7.349E-8	211	0.115	0.218	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
17	PDB:1aqkL	0.239	0.419	7.744E-8	216	0.115	0.213	1aqkL.pdb.gz
18	PDB:3o3uN	0.188	0.142	1.242E-7	580	0.075	0.052	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
19	PDB:4o5lL	0.234	0.411	1.614E-7	215	0.118	0.219	4o5lL.pdb.gz
20	PDB:3oaiA	0.252	0.208	1.889E-7	488	0.063	0.051	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y279	0.0	830	399	1.000	1.000	VSIG4_HUMAN V-set and immunoglobulin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSIG4 PE=1 SV=1
2	F6TUL9	2.10e-73	232	280	0.268	0.382	F6TUL9_MOUSE V-set and immunoglobulin domain containing 4 OS=Mus musculus OX=10090 GN=Vsig4 PE=1 SV=1
3	F7FEU1	2.36e-67	217	285	0.251	0.351	F7FEU1_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
4	A0A8I6AIJ0	2.21e-64	209	281	0.241	0.342	A0A8I6AIJ0_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
5	Q9Y624	9.48e-09	58.5	299	0.158	0.211	JAM1_HUMAN Junctional adhesion molecule A OS=Homo sapiens OX=9606 GN=F11R PE=1 SV=1
6	Q66I72	1.51e-08	57.8	292	0.145	0.199	Q66I72_DANRE Junctional adhesion molecule A OS=Danio rerio OX=7955 GN=JAM PE=1 SV=1
7	Q99795	1.55e-08	58.2	319	0.163	0.204	GPA33_HUMAN Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1
8	Q9JHY1	8.24e-08	55.8	300	0.160	0.213	JAM1_RAT Junctional adhesion molecule A OS=Rattus norvegicus OX=10116 GN=F11r PE=1 SV=1
9	Q9JKA5	1.54e-07	55.1	319	0.135	0.169	GPA33_MOUSE Cell surface A33 antigen OS=Mus musculus OX=10090 GN=Gpa33 PE=2 SV=2
10	O88792	3.27e-07	53.9	300	0.155	0.207	JAM1_MOUSE Junctional adhesion molecule A OS=Mus musculus OX=10090 GN=F11r PE=1 SV=2
11	Q99N28	2.32e-06	51.6	396	0.093	0.093	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
12	P78310	2.99e-06	51.2	365	0.165	0.181	CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1
13	Q9UMF0	3.98e-06	51.6	924	0.103	0.044	ICAM5_HUMAN Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3
14	A0A8I5ZUN3	4.07e-06	51.6	35375	0.093	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
15	A2ASS6	5.37e-06	51.2	35213	0.093	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
16	Q8WZ42	1.22e-05	50.1	34350	0.160	0.002	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
17	Q9JI59	1.41e-05	48.9	298	0.095	0.128	JAM2_MOUSE Junctional adhesion molecule B OS=Mus musculus OX=10090 GN=Jam2 PE=1 SV=1
18	Q6DN72	1.43e-05	49.3	434	0.120	0.111	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
19	Q24372	1.86e-05	48.9	359	0.128	0.142	LACH_DROME Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2
20	G5EG33	2.86e-05	48.9	5198	0.115	0.009	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.1e-09	48.6	Immunoglobulin I-set domain
2	PF00047 ig	1.6e-07	42.7	Immunoglobulin domain
3	PF13895 Ig_2	2.7e-10	51.7	Immunoglobulin domain
4	PF13927 Ig_3	1.9e-12	58.9	Immunoglobulin domain
5	PF18452 Ig_6	0.24	22.7	Immunoglobulin domain
6	PF17736 Ig_C17orf99	0.1	24.0	C17orf99 Ig domain
7	PF16706 Izumo-Ig	28	16.0	Izumo-like Immunoglobulin domain
8	PF15102 TMEM154	5e+02	11.9	TMEM154 protein family
9	PF07686 V-set	2e-15	68.3	Immunoglobulin V-set domain
10	PF08204 V-set_CD47	31	16.0	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245907	0.999	Complement C3
2	9606.ENSP00000313967	0.968	Complement C1q subcomponent subunit B
3	9606.ENSP00000363773	0.966	Complement C1q subcomponent subunit A
4	9606.ENSP00000352071	0.891	Scavenger receptor cysteine-rich type 1 protein M130
5	9606.ENSP00000363770	0.851	Complement C1q subcomponent subunit C
6	9606.ENSP00000286301	0.828	Macrophage colony-stimulating factor 1 receptor
7	9606.ENSP00000302079	0.788	C3a anaphylatoxin chemotactic receptor
8	9606.ENSP00000262629	0.724	TYRO protein tyrosine kinase-binding protein
9	9606.ENSP00000318916	0.717	Macrophage receptor MARCO
10	9606.ENSP00000338648	0.702	Membrane-spanning 4-domains subfamily A member 4A
11	9606.ENSP00000329794	0.693	Transcription elongation factor A protein-like 7
12	9606.ENSP00000331915	0.684	Refilin-B
13	9606.ENSP00000298248	0.680	Lambda-crystallin homolog
14	9606.ENSP00000289902	0.676	High affinity immunoglobulin epsilon receptor subunit gamma
15	9606.ENSP00000352208	0.667	Myoferlin
16	9606.ENSP00000264870	0.665	Coagulation factor XIII A chain
17	9606.ENSP00000298832	0.665	Tubulin polyglutamylase TTLL5
18	9606.ENSP00000286371	0.661	Sodium/potassium-transporting ATPase subunit beta-3
19	9606.ENSP00000296161	0.658	E3 ubiquitin-protein ligase DTX3L
20	9606.ENSP00000298223	0.657	Folate receptor beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001848	1.000	complement binding
GO:0001846	1.000	opsonin binding
GO:0001851	0.517	complement component C3b binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0002682	0.979	regulation of immune system process
GO:0048583	0.971	regulation of response to stimulus
GO:0048519	0.937	negative regulation of biological process
GO:0002683	0.922	negative regulation of immune system process
GO:0050776	0.859	regulation of immune response
GO:0002697	0.840	regulation of immune effector process
GO:0031347	0.834	regulation of defense response
GO:0032101	0.804	regulation of response to external stimulus
GO:0002831	0.743	regulation of response to biotic stimulus
GO:0030449	0.743	regulation of complement activation
GO:0050777	0.737	negative regulation of immune response
GO:0050794	0.702	regulation of cellular process
GO:0002921	0.665	negative regulation of humoral immune response
GO:0045088	0.647	regulation of innate immune response
GO:0032102	0.637	negative regulation of response to external stimulus
GO:0009987	0.629	cellular process
GO:0002832	0.627	negative regulation of response to biotic stimulus
GO:0002698	0.598	negative regulation of immune effector process
GO:0050896	0.595	response to stimulus
GO:0031348	0.581	negative regulation of defense response
GO:0045824	0.506	negative regulation of innate immune response
GO:0048518	0.374	positive regulation of biological process
GO:0019222	0.337	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0032991	0.990	protein-containing complex
GO:0110165	0.961	cellular anatomical entity
GO:0016020	0.916	membrane
GO:0071944	0.886	cell periphery
GO:0005886	0.799	plasma membrane
GO:0005622	0.339	intracellular anatomical structure
GO:0043231	0.318	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]