StarFunc result for job id Q9Y283

User Input

>input (1065 residues)
MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADR
LDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHL
TTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDV
EGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVL
TSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSN
FAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTA
LHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVD
QDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNA
DPNIQDKEGRTALHWSCNNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVI
QFMLEHGALSIAAIQDIAAFKIQAVYKGYKVRKAFRDRKNLLMKHEQLRKDAAAKKREEE
NKRKEAEQQKGRRSPDSCRPQALPCLPSTQDVPSRQSRAPSKQPPAGNVAQGPEPRDSRG
SPGGSLGGALQKEQHVSSDLQGTNSRRPNETAREHSKGQSACVHFRPNEGSDGSRHPGVP
SVEKSRGETAGDERCAKGKGFVKQPSCIRVAGPDEKGEDSRRAAASLPPHDSHWKPSRRH
DTEPKAKCAPQKRRTQELRGGRCSPAGSSRPGSARGEAVHAGQNPPHHRTPRNKVTQAKL
TGGLYSHLPQSTEELRSGARRLETSTLSEDFQVSKETDPAPGPLSGQSVNIDLLPVELRL
QIIQRERRRKELFRKKNKAAAVIQRAWRSYQLRKHLSHLRHMKQLGAGDVDRWRQESTAL
LLQVWRKELELKFPQTTAVSKAPKSPSKGTSGTKSTKHSVLKQIYGCSHEGKIHHPTRSV
KASSVLRLNSVSNLQCIHLLENSGRSKNFSYNLQSATQPKNKTKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y283	0.999	0.999	0.000	1065	1.000	1.000	Q9Y283.pdb.gz	INVS_HUMAN Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2
2	AFDB:O89019	0.597	0.598	7.928E-98	1062	0.806	0.808	O89019.pdb.gz	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
3	PDB:8cs9A	0.372	0.475	2.352E-27	796	0.144	0.192	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	PDB:5vkqA	0.418	0.306	2.041E-20	1499	0.143	0.101	5vkqA.pdb.gz
5	AFDB:A2A690	0.254	0.155	1.825E-18	1994	0.203	0.108	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
6	PDB:4oauC	0.245	0.368	1.134E-11	692	0.078	0.120	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
7	PDB:2dvwA	0.190	0.819	3.338E-10	229	0.061	0.284	2dvwA.pdb.gz
8	PDB:6v9hC	0.200	0.747	2.056E-8	270	0.067	0.263	6v9hC.pdb.gz
9	PDB:1wg0A	0.199	0.812	5.026E-8	243	0.055	0.243	1wg0A.pdb.gz
10	PDB:6aunA	0.219	0.362	2.572E-7	618	0.064	0.110	6aunA.pdb.gz
11	PDB:6jd6B	0.155	0.806	3.944E-7	192	0.044	0.245	6jd6B.pdb.gz
12	PDB:6pqpA	0.172	0.289	4.608E-7	615	0.068	0.117	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
13	PDB:6dmwA	0.201	0.314	1.042E-6	631	0.089	0.151	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
14	AFDB:M9NDA1	0.110	0.096	1.067E-6	1230	0.113	0.098	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
15	AFDB:Q6UB98	0.123	0.066	1.166E-3	2062	0.099	0.051	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
16	AFDB:Q9CXB8	0.093	0.086	3.744E-3	1231	0.113	0.097	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
17	AFDB:Q961B0	0.063	0.063	1.202E-2	1067	0.115	0.114	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
18	AFDB:O95996	0.112	0.074	1.773E-2	2303	0.153	0.071	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
19	AFDB:Q9VS24	0.080	0.081	2.515E-2	994	0.103	0.111	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
20	AFDB:A0A096MKF8	0.088	0.060	2.938E-2	2190	0.110	0.053	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O89019	0.0	1702	1062	0.806	0.808	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
2	Q8UVC1	0.0	993	1021	0.442	0.461	INVS_DANRE Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1
3	Q9Y283	0.0	2215	1065	1.000	1.000	INVS_HUMAN Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2
4	A0A5F9ZHF7	4.68e-56	216	3862	0.159	0.044	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
5	A0A5F9ZH19	2.29e-55	213	3895	0.160	0.044	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
6	Q8N8A2	1.04e-54	209	993	0.164	0.176	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
7	A0A5F9ZHQ3	1.17e-54	211	1838	0.159	0.092	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZHN0	1.40e-54	211	1777	0.159	0.095	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZI73	4.09e-54	209	1822	0.160	0.093	A0A5F9ZI73_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZI53	5.10e-54	209	1755	0.160	0.097	A0A5F9ZI53_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZHR2	5.98e-54	208	1810	0.160	0.094	A0A5F9ZHR2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZGS5	6.20e-54	208	1871	0.160	0.091	A0A5F9ZGS5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHL9	7.87e-54	208	1817	0.160	0.094	A0A5F9ZHL9_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZH58	8.54e-54	208	1770	0.160	0.096	A0A5F9ZH58_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A0G2KBB9	1.15e-53	208	4017	0.163	0.043	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
16	A0A5F9ZH34	8.65e-53	205	1689	0.157	0.099	A0A5F9ZH34_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	Q0KIE7	1.32e-52	204	1549	0.156	0.107	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
18	Q24241	2.08e-52	203	1549	0.157	0.108	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
19	Q9ULJ7	2.58e-51	200	1429	0.151	0.113	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
20	G5EBJ4	1.19e-50	192	624	0.163	0.279	G5EBJ4_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlt-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1e-57	201.5	Ankyrin repeat
2	PF12796 Ank_2	1.2e-85	293.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5e-58	197.0	Ankyrin repeat
4	PF13637 Ank_4	1e-67	234.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.8e-57	201.9	Ankyrin repeats (many copies)
6	PF00612 IQ	7.8e-05	33.1	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.992	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000367766	0.963	X-linked retinitis pigmentosa GTPase regulator
3	9606.ENSP00000005340	0.960	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000268766	0.933	Serine/threonine-protein kinase Nek8
5	9606.ENSP00000338766	0.933	Nephrocystin-3
6	9606.ENSP00000313169	0.919	Nephrocystin-1
7	9606.ENSP00000316054	0.909	Segment polarity protein dishevelled homolog DVL-3
8	9606.ENSP00000238616	0.899	Serine/threonine-protein kinase Nek9
9	9606.ENSP00000367398	0.862	Nephrocystin-4
10	9606.ENSP00000357040	0.818	Vang-like protein 2
11	9606.ENSP00000344456	0.817	Catenin beta-1
12	9606.ENSP00000314004	0.804	Anaphase-promoting complex subunit 2
13	9606.ENSP00000311505	0.803	IQ calmodulin-binding motif-containing protein 1
14	9606.ENSP00000356774	0.797	Jouberin
15	9606.ENSP00000323580	0.792	Intraflagellar transport protein 88 homolog
16	9606.ENSP00000448012	0.778	Centrosomal protein of 290 kDa
17	9606.ENSP00000324527	0.751	Unconventional myosin-Id
18	9606.ENSP00000299163	0.739	Hypoxia-inducible factor 1-alpha inhibitor
19	9606.ENSP00000369257	0.716	Protein fantom
20	9606.ENSP00000389998	0.709	Meckelin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0048523	0.809	negative regulation of cellular process
GO:0030111	0.789	regulation of Wnt signaling pathway
GO:0032501	0.725	multicellular organismal process
GO:0032502	0.683	developmental process
GO:0023057	0.658	negative regulation of signaling
GO:0010648	0.658	negative regulation of cell communication
GO:0060828	0.648	regulation of canonical Wnt signaling pathway
GO:0048856	0.640	anatomical structure development
GO:0030178	0.640	negative regulation of Wnt signaling pathway
GO:0051179	0.527	localization
GO:0090090	0.498	negative regulation of canonical Wnt signaling pathway
GO:0007275	0.377	multicellular organism development
GO:0048518	0.334	positive regulation of biological process
GO:0050896	0.308	response to stimulus
GO:0048522	0.306	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0005622	0.969	intracellular anatomical structure
GO:0043229	0.961	intracellular organelle
GO:0005737	0.903	cytoplasm
GO:0043231	0.753	intracellular membrane-bounded organelle
GO:0043232	0.511	intracellular non-membrane-bounded organelle
GO:0005829	0.389	cytosol
GO:0097543	0.367	ciliary inversin compartment
GO:0097546	0.337	ciliary base
GO:0005856	0.320	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]