StarFunc result for job id Q9Y285

User Input

>input (508 residues)
MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKH
WELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH
SQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVF
SYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDAEPRPPPTQEAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q505J8	0.670	0.670	2.201E-90	508	0.925	0.925	Q505J8.pdb.gz	SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus OX=10116 GN=Farsa PE=1 SV=1
2	PDB:3l4gC	0.610	0.610	6.748E-83	508	1.000	1.000	3l4gC.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
3	AFDB:Q9W3J5	0.675	0.688	8.316E-75	498	0.606	0.618	Q9W3J5.pdb.gz	SYFA_DROME Phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster OX=7227 GN=alpha-PheRS PE=1 SV=1
4	AFDB:Q86B36	0.865	0.884	3.619E-71	496	0.569	0.583	Q86B36.pdb.gz	Q86B36_CAEEL phenylalanine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=fars-1 PE=1 SV=1
5	AFDB:Q9T034	0.808	0.842	2.877E-67	485	0.526	0.551	Q9T034.pdb.gz	SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g39280 PE=2 SV=3
6	AFDB:O42870	0.770	0.782	3.159E-61	499	0.488	0.497	O42870.pdb.gz	SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs2 PE=3 SV=3
7	AFDB:P15625	0.617	0.623	1.173E-59	503	0.470	0.475	P15625.pdb.gz	SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS2 PE=1 SV=3
8	AFDB:Q382C5	0.797	0.815	6.765E-59	496	0.449	0.460	Q382C5.pdb.gz	Q382C5_TRYB2 phenylalanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5710 PE=3 SV=1
9	AFDB:A5K9S0	0.811	0.729	1.298E-56	569	0.421	0.376	A5K9S0.pdb.gz	SYFA_PLAVS Phenylalanine--tRNA ligase alpha subunit OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVX_081300 PE=1 SV=1
10	AFDB:P08312	0.440	0.670	6.516E-24	327	0.197	0.306	P08312.pdb.gz	SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheS PE=1 SV=2
11	AFDB:P9WFU3	0.440	0.646	4.942E-23	341	0.171	0.255	P9WFU3.pdb.gz	SYFA_MYCTU Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pheS PE=1 SV=1
12	PDB:3tehA	0.430	0.790	4.875E-22	266	0.175	0.335	3tehA.pdb.gz	Bacterial and Eukaryotic Phenylalanyl-tRNA Synthetases Catalyze Misaminoacylation of tRNA(Phe) with 3,4-Dihydroxy-L-Phenylalanine.
13	PDB:7k98A	0.439	0.636	1.049E-21	343	0.167	0.248	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
14	PDB:5x6cA	0.407	0.385	2.797E-19	539	0.157	0.148	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
15	PDB:3pcoC	0.425	0.651	3.678E-19	323	0.171	0.269	3pcoC.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
16	PDB:2du3A	0.411	0.392	2.634E-17	534	0.152	0.144	2du3A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
17	PDB:2du4A	0.409	0.443	4.312E-17	466	0.132	0.144	2du4A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
18	PDB:5mguA	0.379	0.467	1.358E-15	407	0.120	0.150	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.
19	PDB:7by6B	0.332	0.282	6.578E-11	606	0.093	0.078	7by6B.pdb.gz	Structural basis of malaria parasite phenylalanine tRNA-synthetase inhibition by bicyclic azetidines.
20	PDB:3dsqB	0.326	0.559	3.401E-10	282	0.089	0.160	3dsqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q505J8	0.0	974	508	0.925	0.925	SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus OX=10116 GN=Farsa PE=1 SV=1
2	Q86B36	0.0	602	496	0.565	0.579	Q86B36_CAEEL phenylalanine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=fars-1 PE=1 SV=1
3	Q9T034	0.0	543	485	0.530	0.555	SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g39280 PE=2 SV=3
4	Q9W3J5	0.0	618	498	0.610	0.622	SYFA_DROME Phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster OX=7227 GN=alpha-PheRS PE=1 SV=1
5	Q9Y285	0.0	1048	508	1.000	1.000	SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3
6	P15625	2.68e-162	471	503	0.469	0.473	SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS2 PE=1 SV=3
7	O42870	3.19e-161	468	499	0.484	0.493	SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs2 PE=3 SV=3
8	Q382C5	1.28e-146	431	496	0.451	0.462	Q382C5_TRYB2 phenylalanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5710 PE=3 SV=1
9	A5K9S0	4.83e-133	399	569	0.421	0.376	SYFA_PLAVS Phenylalanine--tRNA ligase alpha subunit OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVX_081300 PE=1 SV=1
10	P27001	2.53e-35	137	350	0.183	0.266	SYFA_THETH Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus OX=274 GN=pheS PE=1 SV=1
11	P9WFU3	2.72e-33	131	341	0.175	0.261	SYFA_MYCTU Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pheS PE=1 SV=1
12	P08312	2.72e-32	128	327	0.169	0.263	SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheS PE=1 SV=2
13	Q728R9	3.04e-29	120	345	0.165	0.243	SYFA_DESVH Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pheS PE=1 SV=1
14	Q59054	9.21e-18	88.6	539	0.112	0.106	SEPS_METJA O-phosphoserine--tRNA(Cys) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=sepS PE=1 SV=2
15	O30126	3.16e-14	77.4	534	0.106	0.101	SEPS_ARCFU O-phosphoserine--tRNA(Cys) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=sepS PE=1 SV=1
16	O74952	5.50e-11	67.0	429	0.152	0.179	SYFM_SCHPO Phenylalanine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfs1 PE=3 SV=1
17	Q94K73	2.62e-10	64.7	429	0.100	0.119	SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
18	Q99M01	4.84e-09	60.8	451	0.132	0.149	SYFM_MOUSE Phenylalanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Fars2 PE=1 SV=1
19	Q6AYQ3	5.10e-09	60.8	472	0.134	0.144	SYFM_RAT Phenylalanine--tRNA ligase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fars2 PE=2 SV=1
20	O95363	1.39e-08	59.3	451	0.138	0.155	SYFM_HUMAN Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06721 DUF1204	2.2e+02	12.7	Protein of unknown function (DUF1204)
2	PF08279 HTH_11	0.85	20.9	HTH domain
3	PF12802 MarR_2	0.0098	27.2	MarR family
4	PF18552 PheRS_DBD1	7.2e-21	85.0	PheRS DNA binding domain 1
5	PF18554 PheRS_DBD2	2.2e-06	38.8	PheRS DNA binding domain 2
6	PF18553 PheRS_DBD3	1.3e-17	75.1	PheRS DNA binding domain 3
7	PF00152 tRNA-synt_2	2.8	18.6	tRNA synthetases class II (D, K and N)
8	PF01409 tRNA-synt_2d	8.1e-88	305.6	tRNA synthetases class II core domain (F)
9	PF17759 tRNA_synthFbeta	0.009	26.9	Phenylalanyl tRNA synthetase beta chain CLM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281828	0.999	phenylalanyl-tRNA synthetase beta subunit
2	9606.ENSP00000367498	0.972	Leucine-rich repeat-containing protein 47
3	9606.ENSP00000362576	0.968	Tyrosine--tRNA ligase, cytoplasmic
4	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
5	9606.ENSP00000355890	0.915	Bifunctional glutamate/proline--tRNA ligase
6	9606.ENSP00000256854	0.908	Asparagine--tRNA ligase, cytoplasmic
7	9606.ENSP00000325448	0.908	Lysine--tRNA ligase
8	9606.ENSP00000364815	0.897	Valine--tRNA ligase
9	9606.ENSP00000316335	0.894	Phenylalanine--tRNA ligase, mitochondrial
10	9606.ENSP00000387710	0.857	Threonine--tRNA ligase, cytoplasmic
11	9606.ENSP00000264161	0.791	Aspartate--tRNA ligase, cytoplasmic
12	9606.ENSP00000364794	0.791	Isoleucine--tRNA ligase, cytoplasmic
13	9606.ENSP00000425634	0.789	Histidine--tRNA ligase, cytoplasmic
14	9606.ENSP00000338093	0.779	Probable threonine--tRNA ligase 2, cytoplasmic
15	9606.ENSP00000261772	0.774	Alanine--tRNA ligase, cytoplasmic
16	9606.ENSP00000347495	0.773	Tryptophan--tRNA ligase, cytoplasmic
17	9606.ENSP00000467024	0.773	UV excision repair protein RAD23 homolog A
18	9606.ENSP00000373918	0.772	Glycine--tRNA ligase
19	9606.ENSP00000358140	0.759	Eukaryotic translation initiation factor 3 subunit A
20	9606.ENSP00000230340	0.758	Bystin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004826	1.000	phenylalanine-tRNA ligase activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0003723	0.993	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:0034641	0.990	cellular nitrogen compound metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0009058	0.976	biosynthetic process
GO:0044260	0.975	cellular macromolecule metabolic process
GO:0006139	0.975	nucleobase-containing compound metabolic process
GO:0010467	0.974	gene expression
GO:1901576	0.972	organic substance biosynthetic process
GO:0019538	0.972	protein metabolic process
GO:0044249	0.971	cellular biosynthetic process
GO:0016043	0.966	cellular component organization
GO:0090304	0.964	nucleic acid metabolic process
GO:0044271	0.949	cellular nitrogen compound biosynthetic process
GO:0016070	0.942	RNA metabolic process
GO:0044281	0.936	small molecule metabolic process
GO:1901566	0.928	organonitrogen compound biosynthetic process
GO:0006418	0.923	tRNA aminoacylation for protein translation
GO:0044085	0.918	cellular component biogenesis
GO:0022607	0.907	cellular component assembly
GO:0043933	0.902	protein-containing complex organization
GO:0051259	0.892	protein complex oligomerization
GO:0051262	0.840	protein tetramerization
GO:0051291	0.809	protein heterooligomerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0016020	0.976	membrane
GO:0032991	0.972	protein-containing complex
GO:0005829	0.964	cytosol
GO:1902494	0.492	catalytic complex
GO:0005634	0.484	nucleus
GO:0070013	0.393	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19413	1.000	ATP + L-phenylalanine + tRNA(Phe) = AMP + diphosphate + H(+) + L-phenylalanyl-tRNA(Phe)
EC:6.1.1.20	1.000	phenylalanine--tRNA ligase.

[back to server]