StarFunc result for job id Q9Y297

User Input

>input (605 residues)
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z507	0.713	0.679	1.101E-95	636	1.000	0.951	A0A0S2Z507.pdb.gz	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
2	AFDB:Q5SRY7	0.694	0.773	6.925E-79	542	0.755	0.843	Q5SRY7.pdb.gz	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
3	AFDB:A0A2R8QFQ6	0.698	0.750	1.242E-78	562	0.726	0.781	A0A2R8QFQ6.pdb.gz	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
4	AFDB:A0A2R8RWN9	0.681	0.771	1.226E-77	534	0.701	0.794	A0A2R8RWN9.pdb.gz	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
5	AFDB:O44382	0.681	0.807	3.987E-74	510	0.651	0.773	O44382.pdb.gz	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
6	AFDB:Q09990	0.658	0.600	4.001E-63	665	0.522	0.475	Q09990.pdb.gz	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
7	PDB:6ttuT	0.637	0.972	3.742E-61	394	0.650	0.997	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
8	AFDB:P39014	0.514	0.488	1.794E-35	640	0.241	0.228	P39014.pdb.gz	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
9	AFDB:P87053	0.519	0.519	1.530E-34	605	0.251	0.251	P87053.pdb.gz	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
10	AFDB:Q09855	0.505	0.594	1.687E-34	506	0.256	0.306	Q09855.pdb.gz	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
11	AFDB:Q8VBV4	0.467	0.406	8.840E-34	710	0.255	0.217	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
12	PDB:5mzhB	0.431	0.606	9.057E-24	415	0.159	0.231	5mzhB.pdb.gz
13	PDB:5nnzA	0.386	0.664	5.097E-21	335	0.142	0.257	5nnzA.pdb.gz
14	PDB:7bt6x	0.393	0.479	7.902E-21	488	0.142	0.176	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
15	PDB:2h9lA	0.428	0.786	2.308E-20	321	0.127	0.240	2h9lA.pdb.gz
16	PDB:4v7fq	0.381	0.502	2.544E-20	443	0.137	0.187	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
17	PDB:5jcsq	0.392	0.477	4.141E-20	488	0.137	0.170	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
18	PDB:1vyhC	0.434	0.832	4.347E-20	310	0.145	0.284	1vyhC.pdb.gz
19	PDB:7egeE	0.401	0.442	1.152E-19	547	0.164	0.181	7egeE.pdb.gz
20	PDB:6bk8D	0.426	0.703	2.511E-19	359	0.111	0.187	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHK1	0.0	820	597	0.645	0.653	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
2	A0A0S2Z507	0.0	1248	636	1.000	0.951	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
3	A0A2R8QFQ6	0.0	905	562	0.739	0.795	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
4	A0A2R8RWN9	0.0	882	534	0.693	0.785	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
5	B7Z3H4	0.0	1194	579	0.957	1.000	B7Z3H4_HUMAN Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
6	O44382	0.0	819	510	0.645	0.765	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
7	Q09990	0.0	635	665	0.522	0.475	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
8	Q3ULA2	0.0	1249	605	0.987	0.987	FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2
9	Q5SRY7	0.0	921	542	0.732	0.817	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
10	Q91854	0.0	1006	518	0.813	0.950	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1
11	Q9UKB1	0.0	922	542	0.732	0.817	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
12	Q9VDE3	0.0	819	510	0.645	0.765	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
13	Q9Y297	0.0	1263	605	1.000	1.000	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
14	Q09855	6.34e-74	247	506	0.253	0.302	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
15	B7ZDC8	1.37e-68	234	544	0.250	0.278	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
16	Q9VZF4	2.71e-68	243	1326	0.256	0.117	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
17	Q8VBV4	1.54e-66	232	710	0.236	0.201	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
18	Q969H0	2.22e-66	231	707	0.236	0.202	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
19	P87053	9.54e-57	203	605	0.236	0.236	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
20	Q93794	5.82e-49	181	587	0.241	0.249	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.1e-05	36.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12125 Beta-TrCP_D	3.6e-21	86.2	D domain of beta-TrCP
3	PF07433 DUF1513	3.3e+02	11.7	Protein of unknown function (DUF1513)
4	PF14969 DUF4508	2.1e+02	13.6	Domain of unknown function (DUF4508)
5	PF19235 DUF5888	1.3e+02	13.9	Family of unknown function (DUF5888)
6	PF19686 DUF6188	4.1e+02	12.7	Family of unknown function (DUF6188)
7	PF08662 eIF2A	86	14.5	Eukaryotic translation initiation factor eIF2A
8	PF00646 F-box	0.009	27.1	F-box domain
9	PF12937 F-box-like	7.6e-07	40.2	F-box-like
10	PF18511 F-box_5	19	16.2	F-box
11	PF11768 Frtz	90	12.8	WD repeat-containing and planar cell polarity effector protein Fritz
12	PF20426 NBCH_WD40	0.00088	29.8	Neurobeachin beta propeller domain
13	PF11715 Nup160	0.18	22.1	Nucleoporin Nup120/160
14	PF00400 WD40	4.2e-36	133.5	WD domain, G-beta repeat
15	PF17005 WD40_like	0.017	26.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010354424.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010367482.1	0.999	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
2	61622.XP_010372596.1	0.999	Catenin beta-1
3	61622.XP_010358251.1	0.997	Belongs to the SKP1 family.
4	61622.XP_010375845.1	0.997	Ring-box 1
5	61622.XP_010380549.1	0.997	Belongs to the SKP1 family.
6	61622.XP_010383829.1	0.992	NF-kappa-B inhibitor alpha
7	61622.XP_010377339.1	0.985	Yes associated protein 1
8	61622.XP_010374735.1	0.982	Zinc finger protein GLI2
9	61622.XP_010387263.1	0.981	GLI family zinc finger 1
10	61622.XP_010355141.1	0.976	WW domain-containing transcription regulator protein 1 isoform X1
11	61622.XP_010356490.1	0.976	F-box protein 5
12	61622.XP_010362563.1	0.974	Transcriptional activator GLI3 isoform X1
13	61622.XP_010380148.1	0.968	Axin 1
14	61622.XP_010385394.1	0.967	Belongs to the protein kinase superfamily.
15	61622.XP_010356279.1	0.965	Period circadian protein homolog 2 isoform X1
16	61622.XP_010354466.1	0.953	Nuclear factor kappa B subunit 2
17	61622.XP_010373022.1	0.950	Cell division cycle 25A
18	61622.XP_010361621.1	0.949	Nuclear factor kappa B subunit 1
19	61622.XP_010382148.1	0.949	Snail family transcriptional repressor 1
20	61622.XP_010386064.1	0.949	Cell division cycle 34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.938	catalytic activity, acting on a protein
GO:0016740	0.925	transferase activity
GO:0004842	0.683	ubiquitin-protein transferase activity
GO:0008013	0.564	beta-catenin binding
GO:0061659	0.355	ubiquitin-like protein ligase activity
GO:0061630	0.314	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0048518	0.984	positive regulation of biological process
GO:0044248	0.981	cellular catabolic process
GO:1901575	0.980	organic substance catabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0016567	0.977	protein ubiquitination
GO:0080090	0.976	regulation of primary metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0006511	0.968	ubiquitin-dependent protein catabolic process
GO:0010498	0.958	proteasomal protein catabolic process
GO:0000209	0.957	protein polyubiquitination
GO:0032502	0.949	developmental process
GO:0048522	0.949	positive regulation of cellular process
GO:0048856	0.932	anatomical structure development
GO:0043161	0.922	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048583	0.918	regulation of response to stimulus
GO:0010646	0.914	regulation of cell communication
GO:0023051	0.913	regulation of signaling
GO:0050896	0.905	response to stimulus
GO:0042752	0.882	regulation of circadian rhythm
GO:0009889	0.876	regulation of biosynthetic process
GO:0032501	0.870	multicellular organismal process
GO:0009893	0.838	positive regulation of metabolic process
GO:0051173	0.822	positive regulation of nitrogen compound metabolic process
GO:0007275	0.815	multicellular organism development
GO:0009966	0.801	regulation of signal transduction
GO:0048519	0.787	negative regulation of biological process
GO:0031323	0.785	regulation of cellular metabolic process
GO:0010556	0.779	regulation of macromolecule biosynthetic process
GO:0031327	0.778	negative regulation of cellular biosynthetic process
GO:0051252	0.775	regulation of RNA metabolic process
GO:0010468	0.774	regulation of gene expression
GO:0010604	0.765	positive regulation of macromolecule metabolic process
GO:0051246	0.759	regulation of protein metabolic process
GO:0051247	0.754	positive regulation of protein metabolic process
GO:2001141	0.749	regulation of RNA biosynthetic process
GO:0031146	0.738	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:1903506	0.733	regulation of nucleic acid-templated transcription
GO:0010605	0.728	negative regulation of macromolecule metabolic process
GO:0031647	0.726	regulation of protein stability
GO:0006355	0.714	regulation of DNA-templated transcription
GO:0051172	0.711	negative regulation of nitrogen compound metabolic process
GO:0010558	0.702	negative regulation of macromolecule biosynthetic process
GO:0023057	0.691	negative regulation of signaling
GO:1902531	0.686	regulation of intracellular signal transduction
GO:0051716	0.668	cellular response to stimulus
GO:0031648	0.611	protein destabilization
GO:0048731	0.587	system development
GO:0065009	0.544	regulation of molecular function
GO:0031325	0.476	positive regulation of cellular metabolic process
GO:0007154	0.428	cell communication
GO:0051253	0.427	negative regulation of RNA metabolic process
GO:0023052	0.426	signaling
GO:1902679	0.419	negative regulation of RNA biosynthetic process
GO:0007165	0.417	signal transduction
GO:0009653	0.410	anatomical structure morphogenesis
GO:0048585	0.408	negative regulation of response to stimulus
GO:1903507	0.375	negative regulation of nucleic acid-templated transcription
GO:0010648	0.365	negative regulation of cell communication
GO:0009968	0.353	negative regulation of signal transduction
GO:0035239	0.319	tube morphogenesis
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.307	positive regulation of macromolecule biosynthetic process
GO:0031328	0.304	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:1902494	0.989	catalytic complex
GO:1990234	0.983	transferase complex
GO:0140535	0.982	intracellular protein-containing complex
GO:0031461	0.956	cullin-RING ubiquitin ligase complex
GO:0019005	0.931	SCF ubiquitin ligase complex
GO:0043232	0.380	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.925	Transferases.

[back to server]