StarFunc result for job id Q9Y2A7

User Input

>input (1128 residues)
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVF
FDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7useB	0.962	0.988	0.000	1099	0.971	0.996	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
2	AFDB:B0S6R1	0.989	0.989	0.000	1128	0.963	0.963	B0S6R1.pdb.gz	NCKP1_DANRE Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1
3	AFDB:Q8K1X4	0.981	0.976	4.027E-95	1134	0.583	0.580	Q8K1X4.pdb.gz	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
4	AFDB:P55162	0.975	0.977	4.278E-92	1126	0.595	0.596	P55162.pdb.gz	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
5	AFDB:P55163	0.941	0.931	7.417E-75	1141	0.410	0.405	P55163.pdb.gz	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
6	AFDB:Q869Q3	0.862	0.840	1.686E-47	1160	0.257	0.250	Q869Q3.pdb.gz	NAPA_DICDI Nck-associated protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=napA PE=1 SV=1
7	AFDB:Q5S2C4	0.839	0.676	3.848E-37	1425	0.223	0.177	Q5S2C4.pdb.gz	NCKP1_ARATH Protein NAP1 OS=Arabidopsis thaliana OX=3702 GN=NAP1 PE=1 SV=2
8	AFDB:Q7ZVM1	0.379	0.372	4.867E-15	1159	0.121	0.118	Q7ZVM1.pdb.gz	WASC5_DANRE WASH complex subunit 5 OS=Danio rerio OX=7955 GN=washc5 PE=2 SV=1
9	AFDB:Q12768	0.374	0.366	7.379E-15	1159	0.113	0.110	Q12768.pdb.gz	WASC5_HUMAN WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1
10	AFDB:Q54IR8	0.363	0.354	1.119E-14	1164	0.129	0.125	Q54IR8.pdb.gz	WASC5_DICDI WASH complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=washc5 PE=1 SV=1
11	AFDB:Q9VUY8	0.392	0.376	7.420E-13	1191	0.119	0.113	Q9VUY8.pdb.gz	WASC5_DROME WASH complex subunit homolog 5 OS=Drosophila melanogaster OX=7227 GN=Strump PE=1 SV=1
12	PDB:7usdA	0.432	0.415	2.341E-12	1185	0.134	0.127	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
13	PDB:3gjxA	0.085	0.089	2.848E-4	1041	0.106	0.115	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
14	PDB:5yu7A	0.088	0.088	4.627E-4	1118	0.125	0.126	5yu7A.pdb.gz
15	PDB:4bujB	0.099	0.088	4.790E-4	1367	0.138	0.114	4bujB.pdb.gz
16	PDB:3nd2A	0.097	0.115	8.341E-4	861	0.111	0.145	3nd2A.pdb.gz
17	PDB:3icqT	0.096	0.109	9.920E-4	949	0.123	0.146	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
18	PDB:6xu2A	0.073	0.075	1.221E-3	1091	0.102	0.105	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:3m62A	0.096	0.108	1.557E-3	955	0.105	0.124	3m62A.pdb.gz
20	PDB:6tc0C	0.088	0.095	1.557E-3	994	0.112	0.127	6tc0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S6R1	0.0	2285	1128	0.964	0.964	NCKP1_DANRE Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1
2	P28660	0.0	2338	1128	0.994	0.994	NCKP1_MOUSE Nck-associated protein 1 OS=Mus musculus OX=10090 GN=Nckap1 PE=1 SV=2
3	P55160	0.0	1429	1127	0.588	0.588	NCKPL_HUMAN Nck-associated protein 1-like OS=Homo sapiens OX=9606 GN=NCKAP1L PE=1 SV=3
4	P55161	0.0	2333	1128	0.992	0.992	NCKP1_RAT Nck-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nckap1 PE=2 SV=1
5	P55162	0.0	1401	1126	0.596	0.597	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
6	P55163	0.0	890	1141	0.412	0.408	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
7	Q640K3	0.0	2293	1128	0.971	0.971	NCKP1_XENLA Nck-associated protein 1 OS=Xenopus laevis OX=8355 GN=nckap1 PE=2 SV=1
8	Q8K1X4	0.0	1427	1134	0.583	0.580	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
9	Q9Y2A7	0.0	2348	1128	1.000	1.000	NCKP1_HUMAN Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1
10	Q869Q3	1.31e-112	380	1160	0.275	0.267	NAPA_DICDI Nck-associated protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=napA PE=1 SV=1
11	Q5S2C4	3.74e-43	174	1425	0.176	0.139	NCKP1_ARATH Protein NAP1 OS=Arabidopsis thaliana OX=3702 GN=NAP1 PE=1 SV=2
12	Q8I2E3	1.1	35.8	2264	0.043	0.021	Q8I2E3_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0937800 PE=4 SV=1
13	B9P4N3	2.5	34.3	377	0.017	0.050	B9P4N3_DANRE Gonadotropin-releasing hormone receptor-1 OS=Danio rerio OX=7955 GN=gnrhr1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09735 Nckap1	0	1718.2	Nck-associated protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007789

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015485	0.999	WAS protein family, member 1
2	61853.ENSNLEP00000013502	0.998	Belongs to the CYFIP family.
3	61853.ENSNLEP00000020492	0.998	Abl-interactor 1
4	61853.ENSNLEP00000004982	0.996	Belongs to the CYFIP family.
5	61853.ENSNLEP00000008586	0.996	Abl-interactor 2
6	61853.ENSNLEP00000024470	0.992	Uncharacterized protein
7	61853.ENSNLEP00000011724	0.991	Belongs to the eukaryotic ribosomal protein eS26 family.
8	61853.ENSNLEP00000017105	0.990	WAS protein family, member 3
9	61853.ENSNLEP00000021402	0.971	NCK-associated protein 1-like
10	61853.ENSNLEP00000017956	0.967	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
11	61853.ENSNLEP00000019034	0.932	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
12	61853.ENSNLEP00000005090	0.917	Actin-related protein 2/3 complex subunit 4
13	61853.ENSNLEP00000010284	0.915	Arp2/3 complex 34 kDa subunit
14	61853.ENSNLEP00000003430	0.906	Actin-related protein 2/3 complex subunit 3
15	61853.ENSNLEP00000004957	0.906	NCK adaptor protein 1
16	61853.ENSNLEP00000021894	0.893	Actin-related protein 2/3 complex subunit 5
17	61853.ENSNLEP00000014778	0.876	Wiskott-Aldrich syndrome-like
18	61853.ENSNLEP00000013359	0.873	Actin related protein 2/3 complex, subunit 1A, 41kDa
19	61853.ENSNLEP00000021017	0.870	Actin-related protein 2/3 complex subunit 5
20	61853.ENSNLEP00000017256	0.852	ADP-ribosylation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.405	enzyme binding
GO:0031267	0.313	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0050896	0.907	response to stimulus
GO:0035556	0.866	intracellular signal transduction
GO:0048856	0.858	anatomical structure development
GO:0007275	0.853	multicellular organism development
GO:0016043	0.843	cellular component organization
GO:0032956	0.821	regulation of actin cytoskeleton organization
GO:0044089	0.820	positive regulation of cellular component biogenesis
GO:0007399	0.793	nervous system development
GO:0110053	0.671	regulation of actin filament organization
GO:0120034	0.539	positive regulation of plasma membrane bounded cell projection assembly
GO:0009653	0.449	anatomical structure morphogenesis
GO:0010591	0.390	regulation of lamellipodium assembly
GO:1902745	0.390	positive regulation of lamellipodium organization
GO:0035148	0.367	tube formation
GO:0030030	0.300	cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.995	protein-containing complex
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.992	cytoplasm
GO:0043229	0.991	intracellular organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0031941	0.949	filamentous actin
GO:0043227	0.937	membrane-bounded organelle
GO:0031209	0.928	SCAR complex
GO:0005886	0.883	plasma membrane
GO:0030054	0.869	cell junction
GO:0043231	0.710	intracellular membrane-bounded organelle
GO:0042995	0.694	cell projection
GO:0031982	0.689	vesicle
GO:0005576	0.612	extracellular region
GO:0005829	0.609	cytosol
GO:0005634	0.533	nucleus
GO:0043233	0.426	organelle lumen
GO:0031981	0.396	nuclear lumen
GO:0140535	0.391	intracellular protein-containing complex
GO:0043005	0.390	neuron projection
GO:0005768	0.386	endosome
GO:0005654	0.379	nucleoplasm
GO:0005615	0.353	extracellular space
GO:0044297	0.351	cell body
GO:0036477	0.350	somatodendritic compartment
GO:1903561	0.342	extracellular vesicle
GO:0070062	0.333	extracellular exosome
GO:0045202	0.324	synapse
GO:0030055	0.307	cell-substrate junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]