StarFunc result for job id Q9Y2A9

User Input

>input (372 residues)
MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAP
CHANTSMVTHPDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNY
VRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHD
SFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQ
NVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL
GMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYEMLLMWDALNQ
PNLTCGNQTQIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2A9	1.000	1.000	1.387E-81	372	1.000	1.000	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
2	AFDB:Q6ZMB0	0.823	0.798	5.632E-48	384	0.511	0.495	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
3	AFDB:Q8K0J2	0.800	0.750	4.863E-43	397	0.433	0.406	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
4	AFDB:Q8NFL0	0.798	0.742	5.830E-43	401	0.419	0.389	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
5	AFDB:Q9C0J1	0.768	0.756	1.198E-41	378	0.398	0.392	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	AFDB:Q9Z222	0.772	0.725	4.178E-37	397	0.368	0.345	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	PDB:7jhiC	0.761	0.853	1.308E-34	331	0.331	0.372	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
8	AFDB:Q9NY97	0.770	0.723	2.536E-34	397	0.349	0.327	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
9	AFDB:Q7Z7M8	0.718	0.675	1.008E-31	397	0.328	0.307	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
10	AFDB:O54904	0.668	0.758	1.827E-29	326	0.266	0.304	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	AFDB:Q9Y2C3	0.671	0.800	2.459E-28	310	0.234	0.281	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
12	PDB:6fxrA	0.328	0.192	1.349E-5	700	0.075	0.040	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4fixA	0.332	0.214	7.791E-5	629	0.108	0.064	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:4y63A	0.346	0.435	7.791E-5	282	0.102	0.135	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
15	PDB:4hg6A	0.359	0.192	9.922E-5	747	0.099	0.050	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
16	PDB:1mc3A	0.289	0.344	4.234E-4	291	0.067	0.086	1mc3A.pdb.gz	Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+
17	PDB:1i52A	0.277	0.410	5.076E-4	225	0.075	0.124	1i52A.pdb.gz	Structure of 4-diphosphocytidyl-2-C- methylerythritol synthetase involved in mevalonate- independent isoprenoid biosynthesis.
18	PDB:7x8kB	0.257	0.260	5.393E-4	367	0.083	0.084	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
19	PDB:1ll0B	0.330	0.431	5.729E-4	267	0.108	0.150	1ll0B.pdb.gz
20	PDB:5vcmB	0.252	0.259	5.729E-4	358	0.099	0.103	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2A9	0.0	768	372	1.000	1.000	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
2	Q6ZMB0	1.96e-116	345	384	0.500	0.484	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
3	Q8K0J2	2.69e-97	296	397	0.417	0.390	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
4	Q8NFL0	1.39e-92	285	401	0.392	0.364	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
5	Q9C0J1	9.81e-79	248	378	0.352	0.347	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	Q9Z222	4.57e-77	244	397	0.352	0.330	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	Q9NY97	1.57e-72	233	397	0.336	0.315	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
8	O54904	1.19e-46	163	326	0.234	0.267	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
9	Q9Y5Z6	1.19e-46	163	326	0.234	0.267	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
10	Q9BYG0	2.58e-46	164	378	0.274	0.270	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
11	Q9Y2C3	2.55e-45	159	310	0.242	0.290	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
12	Q8BGY6	4.28e-45	160	376	0.282	0.279	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
13	Q7Z7M8	5.78e-45	161	397	0.288	0.270	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
14	Q99NB2	1.31e-42	154	377	0.247	0.244	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
15	Q9JI67	1.12e-40	147	308	0.226	0.273	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
16	O54905	1.72e-34	133	422	0.215	0.190	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
17	O43825	3.96e-34	132	422	0.218	0.192	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
18	Q24157	1.68e-33	129	325	0.237	0.271	BRN_DROME Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2
19	O75752	2.66e-32	125	331	0.234	0.263	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
20	Q920V1	1.72e-29	118	331	0.228	0.257	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	1.4	19.9	Fringe-like
2	PF01762 Galactosyl_T	7.1e-39	145.2	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415454	0.959	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
2	9606.ENSP00000305603	0.955	Galactoside 3(4)-L-fucosyltransferase
3	9606.ENSP00000379377	0.955	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
4	9606.ENSP00000368917	0.954	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
5	9606.ENSP00000317027	0.950	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
6	9606.ENSP00000312021	0.948	Galactoside 2-alpha-L-fucosyltransferase 1
7	9606.ENSP00000313398	0.943	Alpha-(1,3)-fucosyltransferase 6
8	9606.ENSP00000387498	0.942	Galactoside 2-alpha-L-fucosyltransferase 2
9	9606.ENSP00000351602	0.941	Alpha-(1,3)-fucosyltransferase 4
10	9606.ENSP00000480884	0.941	Type 2 lactosamine alpha-2,3-sialyltransferase
11	9606.ENSP00000369055	0.940	Beta-1,4-galactosyltransferase 1
12	9606.ENSP00000310696	0.936	Beta-1,4-galactosyltransferase 2
13	9606.ENSP00000420161	0.935	Beta-1,4-galactosyltransferase 4
14	9606.ENSP00000302716	0.931	Mucin-17
15	9606.ENSP00000482600	0.931	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7
16	9606.ENSP00000417498	0.930	Mucin-4
17	9606.ENSP00000484824	0.930	Mucin-1
18	9606.ENSP00000414350	0.928	Mucin-20
19	9606.ENSP00000381008	0.922	Mucin-16
20	9606.ENSP00000406861	0.922	Mucin-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0008499	0.997	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0005515	0.768	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006493	0.995	protein O-linked glycosylation
GO:0005975	0.984	carbohydrate metabolic process
GO:0016051	0.974	carbohydrate biosynthetic process
GO:0044272	0.897	sulfur compound biosynthetic process
GO:0006024	0.890	glycosaminoglycan biosynthetic process
GO:0044264	0.844	cellular polysaccharide metabolic process
GO:0034637	0.840	cellular carbohydrate biosynthetic process
GO:1903510	0.832	mucopolysaccharide metabolic process
GO:0033692	0.703	cellular polysaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005886	0.977	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]