StarFunc result for job id Q9Y2C2

User Input

>input (406 residues)
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCL
GSLLYQLSGGPPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
LLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGD
QPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPEC
SNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPH
YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKR
KFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BUB6	0.761	0.759	2.722E-63	407	0.961	0.958	Q8BUB6.pdb.gz	UST_MOUSE Uronyl 2-sulfotransferase OS=Mus musculus OX=10090 GN=Ust PE=2 SV=3
2	AFDB:P25722	0.593	0.686	2.709E-22	349	0.239	0.278	P25722.pdb.gz	HS2ST_DROME Heparin sulfate O-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=Hs2st PE=2 SV=2
3	AFDB:A1L1P8	0.578	0.658	7.432E-22	354	0.244	0.280	A1L1P8.pdb.gz	A1L1P8_DANRE Heparan sulfate 2-O-sulfotransferase 1 OS=Danio rerio OX=7955 GN=HS2st1 PE=1 SV=1
4	AFDB:O08889	0.589	0.667	1.078E-21	356	0.236	0.270	O08889.pdb.gz	HS2ST_CRILO Heparan sulfate 2-O-sulfotransferase 1 OS=Cricetulus longicaudatus OX=10030 GN=HS2ST1 PE=1 SV=1
5	PDB:3f5fA	0.565	0.355	1.025E-20	656	0.204	0.127	3f5fA.pdb.gz	Redirecting the substrate specificity of heparan sulfate 2-O-sulfotransferase by structurally guided mutagenesis.
6	AFDB:O17645	0.572	0.709	2.348E-20	324	0.239	0.299	O17645.pdb.gz	HST2_CAEEL Heparan sulfate 2-O-sulfotransferase hst-2 OS=Caenorhabditis elegans OX=6239 GN=hst-2 PE=1 SV=2
7	AFDB:Q86BJ3	0.570	0.454	3.463E-18	514	0.207	0.163	Q86BJ3.pdb.gz	PIPE_DROME Heparan sulfate 2-O-sulfotransferase pipe OS=Drosophila melanogaster OX=7227 GN=pip PE=1 SV=1
8	AFDB:Q99999	0.401	0.387	1.852E-7	423	0.160	0.154	Q99999.pdb.gz	G3ST1_HUMAN Galactosylceramide sulfotransferase OS=Homo sapiens OX=9606 GN=GAL3ST1 PE=1 SV=1
9	AFDB:Q96A11	0.392	0.371	4.569E-7	431	0.133	0.125	Q96A11.pdb.gz	G3ST3_HUMAN Galactose-3-O-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=GAL3ST3 PE=1 SV=1
10	PDB:5t05B	0.333	0.213	2.689E-3	677	0.094	0.056	5t05B.pdb.gz	Structure Based Substrate Specificity Analysis of Heparan Sulfate 6-O-Sulfotransferases.
11	PDB:1zd1A	0.248	0.366	5.965E-3	251	0.091	0.147	1zd1A.pdb.gz
12	PDB:1j99A	0.294	0.395	7.377E-3	284	0.116	0.165	1j99A.pdb.gz	Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
13	PDB:3bfxA	0.244	0.360	7.377E-3	253	0.089	0.142	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
14	PDB:5mekA	0.288	0.348	1.015E-2	322	0.103	0.130	5mekA.pdb.gz	Structural and biochemical studies of sulphotransferase 18 from Arabidopsis thaliana explain its substrate specificity and reaction mechanism.
15	AFDB:Q8BGL3	0.311	0.415	1.296E-2	282	0.099	0.142	Q8BGL3.pdb.gz	ST2A8_MOUSE Sulfotransferase 2A8 OS=Mus musculus OX=10090 GN=Sult2a8 PE=1 SV=1
16	PDB:2gwhB	0.299	0.391	1.472E-2	288	0.089	0.125	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
17	PDB:3cklB	0.302	0.391	1.919E-2	296	0.103	0.142	3cklB.pdb.gz	Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
18	PDB:1aqyA	0.232	0.314	2.024E-2	283	0.094	0.134	1aqyA.pdb.gz	Crystal structure of estrogen sulphotransferase.
19	PDB:3mgbA	0.250	0.323	2.024E-2	286	0.096	0.136	3mgbA.pdb.gz	Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
20	AFDB:Q80WV3	0.304	0.249	9.757E-2	530	0.172	0.132	Q80WV3.pdb.gz	CHST2_MOUSE Carbohydrate sulfotransferase 2 OS=Mus musculus OX=10090 GN=Chst2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BUB6	0.0	805	407	0.961	0.958	UST_MOUSE Uronyl 2-sulfotransferase OS=Mus musculus OX=10090 GN=Ust PE=2 SV=3
2	Q9Y2C2	0.0	836	406	1.000	1.000	UST_HUMAN Uronyl 2-sulfotransferase OS=Homo sapiens OX=9606 GN=UST PE=2 SV=1
3	Q7LGA3	2.41e-40	149	356	0.209	0.239	HS2ST_HUMAN Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1 PE=1 SV=1
4	O08889	2.97e-40	148	356	0.209	0.239	HS2ST_CRILO Heparan sulfate 2-O-sulfotransferase 1 OS=Cricetulus longicaudatus OX=10030 GN=HS2ST1 PE=1 SV=1
5	Q8R3H7	3.03e-40	148	356	0.209	0.239	HS2ST_MOUSE Heparan sulfate 2-O-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Hs2st1 PE=1 SV=2
6	A1L1P8	4.31e-40	148	354	0.219	0.251	A1L1P8_DANRE Heparan sulfate 2-O-sulfotransferase 1 OS=Danio rerio OX=7955 GN=HS2st1 PE=1 SV=1
7	Q76KB1	5.04e-40	147	356	0.212	0.242	HS2ST_CHICK Heparan sulfate 2-O-sulfotransferase 1 OS=Gallus gallus OX=9031 GN=HS2ST1 PE=1 SV=1
8	P25722	7.94e-37	139	349	0.222	0.258	HS2ST_DROME Heparin sulfate O-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=Hs2st PE=2 SV=2
9	O17645	1.09e-35	135	324	0.234	0.293	HST2_CAEEL Heparan sulfate 2-O-sulfotransferase hst-2 OS=Caenorhabditis elegans OX=6239 GN=hst-2 PE=1 SV=2
10	Q86BJ3	2.29e-26	112	514	0.187	0.148	PIPE_DROME Heparan sulfate 2-O-sulfotransferase pipe OS=Drosophila melanogaster OX=7227 GN=pip PE=1 SV=1
11	Q800H9	0.91	34.3	468	0.123	0.107	H6ST2_DANRE Heparan-sulfate 6-O-sulfotransferase 2 OS=Danio rerio OX=7955 GN=hs6st2 PE=2 SV=2
12	Q90827	7.0	31.6	816	0.054	0.027	NEL_CHICK Protein NEL OS=Gallus gallus OX=9031 GN=NEL PE=2 SV=1
13	F4JM15	8.0	31.2	440	0.044	0.041	F4JM15_ARATH PfkB-like carbohydrate kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g28706 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06990 Gal-3-0_sulfotr	0.0014	29.2	Galactose-3-O-sulfotransferase
2	PF03567 Sulfotransfer_2	1.9e-33	128.3	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362207	0.980	Carbohydrate sulfotransferase 3
2	9606.ENSP00000305725	0.979	Carbohydrate sulfotransferase 11
3	9606.ENSP00000276055	0.977	Carbohydrate sulfotransferase 7
4	9606.ENSP00000481912	0.976	Carbohydrate sulfotransferase 12
5	9606.ENSP00000332151	0.970	Dermatan-sulfate epimerase
6	9606.ENSP00000317404	0.934	Carbohydrate sulfotransferase 13
7	9606.ENSP00000309270	0.920	Carbohydrate sulfotransferase 1
8	9606.ENSP00000307911	0.918	Carbohydrate sulfotransferase 2
9	9606.ENSP00000052754	0.911	Decorin
10	9606.ENSP00000252575	0.910	Neurocan core protein
11	9606.ENSP00000265077	0.909	Versican core protein
12	9606.ENSP00000312506	0.909	Chondroitin sulfate proteoglycan 4
13	9606.ENSP00000331210	0.902	Brevican core protein
14	9606.ENSP00000327336	0.900	Biglycan
15	9606.ENSP00000373244	0.900	Chondroitin sulfate proteoglycan 5
16	9606.ENSP00000002596	0.871	Heparan sulfate glucosamine 3-O-sulfotransferase 1
17	9606.ENSP00000427888	0.789	Heparan sulfate glucosamine 3-O-sulfotransferase 5
18	9606.ENSP00000310657	0.755	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
19	9606.ENSP00000261797	0.728	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
20	9606.ENSP00000307297	0.727	Carbohydrate sulfotransferase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008146	1.000	sulfotransferase activity
GO:0005488	0.959	binding
GO:0005515	0.928	protein binding
GO:0034483	0.925	heparan sulfate sulfotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901135	0.996	carbohydrate derivative metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0009100	0.991	glycoprotein metabolic process
GO:1901137	0.990	carbohydrate derivative biosynthetic process
GO:0009059	0.989	macromolecule biosynthetic process
GO:1901566	0.989	organonitrogen compound biosynthetic process
GO:1903510	0.985	mucopolysaccharide metabolic process
GO:0006024	0.978	glycosaminoglycan biosynthetic process
GO:0044272	0.969	sulfur compound biosynthetic process
GO:0030166	0.946	proteoglycan biosynthetic process
GO:0005975	0.905	carbohydrate metabolic process
GO:0050789	0.866	regulation of biological process
GO:0044281	0.814	small molecule metabolic process
GO:0005996	0.661	monosaccharide metabolic process
GO:0044283	0.617	small molecule biosynthetic process
GO:0050794	0.576	regulation of cellular process
GO:0016051	0.573	carbohydrate biosynthetic process
GO:0046364	0.458	monosaccharide biosynthetic process
GO:0051923	0.317	sulfation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0070013	0.404	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.-	1.000	Sulfotransferases.

[back to server]