StarFunc result for job id Q9Y2C4

User Input

>input (368 residues)
MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKA
VLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNI
PPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEM
YCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVS
TEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCK
LLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQS
GTQIRKPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2C4	1.000	1.000	1.278E-75	368	1.000	1.000	Q9Y2C4.pdb.gz	EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=2
2	AFDB:Q8C163	0.858	0.858	6.164E-67	368	0.832	0.832	Q8C163.pdb.gz	EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus OX=10090 GN=Exog PE=1 SV=1
3	AFDB:Q3V5X8	0.618	0.767	2.773E-32	294	0.291	0.364	Q3V5X8.pdb.gz
4	AFDB:Q5BB95	0.647	0.710	2.388E-31	334	0.302	0.332	Q5BB95.pdb.gz	Q5BB95_EMENI Endonuclease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02185 PE=3 SV=1
5	AFDB:Q95NM6	0.596	0.708	2.540E-31	308	0.280	0.334	Q95NM6.pdb.gz	NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cps-6 PE=1 SV=1
6	AFDB:Q10480	0.668	0.759	5.652E-31	322	0.264	0.301	Q10480.pdb.gz	PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnu1 PE=2 SV=2
7	AFDB:P38447	0.605	0.741	6.797E-31	299	0.261	0.321	P38447.pdb.gz	NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus OX=9913 GN=ENDOG PE=1 SV=1
8	AFDB:P08466	0.642	0.716	1.608E-30	329	0.283	0.316	P08466.pdb.gz	NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUC1 PE=1 SV=1
9	AFDB:Q7JXB9	0.564	0.668	3.278E-29	310	0.272	0.323	Q7JXB9.pdb.gz	Q7JXB9_DROME Endonuclease OS=Drosophila melanogaster OX=7227 GN=EndoG PE=1 SV=1
10	PDB:5s9mA	0.491	0.236	3.049E-14	809	0.139	0.063	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
11	AFDB:E2RUH0	0.498	0.224	6.682E-14	859	0.136	0.058	E2RUH0.pdb.gz	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
12	PDB:3wayA	0.484	0.238	7.216E-14	787	0.149	0.070	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
13	PDB:6wevAbA	0.481	0.231	5.692E-12	817	0.144	0.065	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
14	PDB:6c01A	0.480	0.228	7.280E-12	819	0.139	0.062	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
15	PDB:6g4gD	0.434	0.217	6.667E-11	781	0.130	0.061	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
16	PDB:6g4gB	0.470	0.240	4.490E-10	759	0.144	0.070	6g4gB.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
17	PDB:6xkdB	0.411	0.232	4.774E-10	681	0.117	0.063	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
18	PDB:4b56A	0.412	0.200	2.514E-9	816	0.125	0.056	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
19	PDB:6g4gC	0.399	0.209	7.607E-9	742	0.114	0.057	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
20	PDB:5nj5A	0.115	0.092	2.769E-1	480	0.033	0.025	5nj5A.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C163	0.0	620	368	0.832	0.832	EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus OX=10090 GN=Exog PE=1 SV=1
2	Q9Y2C4	0.0	766	368	1.000	1.000	EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=2
3	H7C0W6	5.11e-134	382	187	0.481	0.947	H7C0W6_HUMAN Exo/endonuclease G (Fragment) OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=1
4	O08600	6.28e-56	186	294	0.266	0.333	NUCG_MOUSE Endonuclease G, mitochondrial OS=Mus musculus OX=10090 GN=Endog PE=1 SV=1
5	Q7JXB9	1.04e-54	184	310	0.250	0.297	Q7JXB9_DROME Endonuclease OS=Drosophila melanogaster OX=7227 GN=EndoG PE=1 SV=1
6	Q5BB95	5.47e-54	182	334	0.291	0.320	Q5BB95_EMENI Endonuclease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02185 PE=3 SV=1
7	Q14249	5.58e-54	181	297	0.253	0.313	NUCG_HUMAN Endonuclease G, mitochondrial OS=Homo sapiens OX=9606 GN=ENDOG PE=1 SV=4
8	Q95NM6	3.23e-53	180	308	0.255	0.305	NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cps-6 PE=1 SV=1
9	P38447	4.54e-52	177	299	0.245	0.301	NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus OX=9913 GN=ENDOG PE=1 SV=1
10	Q10480	6.04e-47	164	322	0.255	0.292	PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnu1 PE=2 SV=2
11	P08466	1.02e-46	164	329	0.288	0.322	NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUC1 PE=1 SV=1
12	P22413	0.011	40.4	925	0.136	0.054	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
13	B2RBY8	0.023	39.3	873	0.130	0.055	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
14	O14638	0.023	39.3	875	0.147	0.062	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
15	P06802	0.12	37.0	906	0.114	0.046	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
16	Q924C3	0.22	36.2	906	0.111	0.045	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
17	O94919	0.30	35.4	500	0.092	0.068	ENDD1_HUMAN Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2
18	Q6PGY9	0.66	34.7	850	0.141	0.061	Q6PGY9_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Danio rerio OX=7955 GN=atx PE=2 SV=1
19	Q9VAU2	1.8	32.7	370	0.062	0.062	Q9VAU2_DROME IP21418p OS=Drosophila melanogaster OX=7227 GN=Sid PE=2 SV=1
20	Q9LY28	3.3	32.3	479	0.065	0.050	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20503 DUF6730	19	17.6	Family of unknown function (DUF6730)
2	PF01223 Endonuclease_NS	1.5e-56	203.3	DNA/RNA non-specific endonuclease
3	PF18026 Exog_C	2.3e-24	96.4	Endo/exonuclease (EXOG) C-terminal domain
4	PF09518 RE_HindIII	12	16.6	HindIII restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287675

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305480	0.858	Flap endonuclease 1
2	9606.ENSP00000337445	0.762	Zinc phosphodiesterase ELAC protein 2
3	9606.ENSP00000366939	0.745	Mitochondrial genome maintenance exonuclease 1
4	9606.ENSP00000287295	0.720	Apoptosis-inducing factor 1, mitochondrial
5	9606.ENSP00000355759	0.708	Poly [ADP-ribose] polymerase 1
6	9606.ENSP00000351185	0.689	DNA replication ATP-dependent helicase/nuclease DNA2
7	9606.ENSP00000355566	0.640	Mitochondrial import receptor subunit TOM20 homolog
8	9606.ENSP00000384331	0.635	Protein CEBPZOS
9	9606.ENSP00000317579	0.632	RUS1 family protein C16orf58
10	9606.ENSP00000309142	0.631	2',5'-phosphodiesterase 12
11	9606.ENSP00000268124	0.622	DNA polymerase subunit gamma-1
12	9606.ENSP00000216714	0.621	DNA-(apurinic or apyrimidinic site) lyase
13	9606.ENSP00000269466	0.617	Zinc phosphodiesterase ELAC protein 1
14	9606.ENSP00000367787	0.609	DNA ligase 3
15	9606.ENSP00000309595	0.599	Twinkle protein, mitochondrial
16	9606.ENSP00000457788	0.561	Alpha-mannosidase 2C1
17	9606.ENSP00000457513	0.520	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
18	9606.ENSP00000307786	0.506	Cytochrome c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004519	0.999	endonuclease activity
GO:0008409	0.999	5'-3' exonuclease activity
GO:0140097	0.980	catalytic activity, acting on DNA
GO:0004536	0.942	deoxyribonuclease activity
GO:0005515	0.878	protein binding
GO:0004520	0.458	DNA endonuclease activity
GO:1901363	0.390	heterocyclic compound binding
GO:0097159	0.383	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:1901575	0.982	organic substance catabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.972	macromolecule metabolic process
GO:0006139	0.957	nucleobase-containing compound metabolic process
GO:0071840	0.947	cellular component organization or biogenesis
GO:0065007	0.944	biological regulation
GO:0090304	0.895	nucleic acid metabolic process
GO:0050794	0.890	regulation of cellular process
GO:0016043	0.872	cellular component organization
GO:0044260	0.866	cellular macromolecule metabolic process
GO:1901361	0.810	organic cyclic compound catabolic process
GO:0034655	0.757	nucleobase-containing compound catabolic process
GO:0050896	0.739	response to stimulus
GO:0006259	0.694	DNA metabolic process
GO:0044265	0.658	cellular macromolecule catabolic process
GO:0019222	0.649	regulation of metabolic process
GO:0048518	0.536	positive regulation of biological process
GO:0051716	0.507	cellular response to stimulus
GO:0031323	0.498	regulation of cellular metabolic process
GO:0048522	0.497	positive regulation of cellular process
GO:0080090	0.481	regulation of primary metabolic process
GO:0006996	0.467	organelle organization
GO:0051171	0.446	regulation of nitrogen compound metabolic process
GO:0006950	0.432	response to stress
GO:0007005	0.418	mitochondrion organization
GO:0009893	0.410	positive regulation of metabolic process
GO:0048519	0.385	negative regulation of biological process
GO:0008219	0.375	cell death
GO:0016070	0.370	RNA metabolic process
GO:0012501	0.369	programmed cell death
GO:0048523	0.364	negative regulation of cellular process
GO:0033554	0.337	cellular response to stress
GO:0019219	0.321	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0032991	0.990	protein-containing complex
GO:0016020	0.959	membrane
GO:0031090	0.863	organelle membrane
GO:0031967	0.815	organelle envelope
GO:0005743	0.641	mitochondrial inner membrane
GO:0005634	0.608	nucleus
GO:0070013	0.575	intracellular organelle lumen
GO:0031981	0.493	nuclear lumen
GO:0043232	0.426	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.999	Acting on ester bonds.

[back to server]