StarFunc result for job id Q9Y2C9

User Input

>input (796 residues)
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2C9	1.000	1.000	0.000	796	1.000	1.000	Q9Y2C9.pdb.gz	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
2	AFDB:Q9EPW9	0.911	0.912	1.925E-103	795	0.736	0.737	Q9EPW9.pdb.gz	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
3	AFDB:G3V695	0.764	0.751	4.571E-98	811	0.719	0.705	G3V695.pdb.gz	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
4	AFDB:Q15399	0.856	0.866	1.080E-88	786	0.675	0.683	Q15399.pdb.gz	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
5	AFDB:Q9EPQ1	0.880	0.881	5.259E-85	795	0.603	0.604	Q9EPQ1.pdb.gz	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
6	AFDB:E9PTL5	0.864	0.878	2.553E-79	783	0.562	0.571	E9PTL5.pdb.gz	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
7	AFDB:F6SU23	0.652	0.636	1.884E-68	818	0.480	0.467	F6SU23.pdb.gz
8	AFDB:Q9BXR5	0.774	0.761	7.180E-66	811	0.470	0.461	Q9BXR5.pdb.gz	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
9	AFDB:A5H0S2	0.480	0.581	5.409E-54	652	0.388	0.474	A5H0S2.pdb.gz	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
10	AFDB:E9PTD9	0.563	0.571	4.457E-42	784	0.295	0.300	E9PTD9.pdb.gz	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
11	PDB:3j0aA	0.331	0.330	3.080E-21	797	0.191	0.191	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.394	0.449	7.146E-15	668	0.153	0.183	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:7tvfD	0.273	0.385	1.742E-12	515	0.139	0.216	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:6gffI	0.330	0.447	2.660E-11	551	0.139	0.201	6gffI.pdb.gz
15	PDB:3t6qA	0.287	0.359	5.201E-11	601	0.129	0.171	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:3b2dA	0.340	0.412	2.376E-10	601	0.155	0.205	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7wrqA	0.343	0.454	2.214E-7	566	0.122	0.171	7wrqA.pdb.gz
18	PDB:6hkwA	0.160	0.332	1.080E-5	306	0.080	0.209	6hkwA.pdb.gz
19	PDB:2ft3F	0.132	0.307	2.020E-5	305	0.089	0.233	2ft3F.pdb.gz
20	PDB:1xcdA	0.127	0.290	2.309E-5	305	0.093	0.243	1xcdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKA9	0.0	1234	806	0.742	0.733	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
2	A5H0S2	0.0	625	652	0.389	0.475	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
3	E9PTL5	0.0	977	808	0.598	0.589	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
4	G3V695	0.0	1198	811	0.722	0.709	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
5	Q15399	0.0	1106	786	0.678	0.687	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
6	Q5WA51	0.0	739	818	0.489	0.476	Q5WA51_CHICK Toll-like receptor 1 OS=Gallus gallus OX=9031 GN=TLR1 PE=2 SV=1
7	Q6P690	0.0	1236	806	0.742	0.733	Q6P690_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=2 SV=1
8	Q9BXR5	0.0	726	811	0.480	0.471	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
9	Q9EPQ1	0.0	984	795	0.602	0.603	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
10	Q9EPW9	0.0	1221	795	0.739	0.740	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
11	Q9Y2C9	0.0	1634	796	1.000	1.000	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
12	Q9QUN7	6.00e-104	339	784	0.308	0.312	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
13	O60603	4.42e-101	332	784	0.310	0.315	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
14	Q6YGU2	2.03e-95	317	784	0.310	0.315	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
15	E9PTD9	3.67e-95	316	784	0.310	0.315	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
16	Q9DD78	1.19e-89	301	793	0.293	0.294	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
17	F1QWS9	2.31e-83	285	818	0.280	0.273	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
18	Q6TS42	5.06e-83	283	788	0.283	0.286	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
19	Q2XQ10	2.80e-60	221	868	0.153	0.141	Q2XQ10_CHICK Toll-like receptor 2 OS=Gallus gallus OX=9031 GN=TLR15 PE=2 SV=1
20	A0A2R8RTN4	6.01e-38	155	955	0.131	0.109	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	0.16	23.6	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	4.5	19.0	Leucine Rich Repeat
3	PF12799 LRR_4	4.2e-12	57.3	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.005	27.9	Leucine Rich repeat
5	PF13855 LRR_8	2.2e-17	73.9	Leucine rich repeat
6	PF14580 LRR_9	4.3	18.4	Leucine-rich repeat
7	PF01582 TIR	8e-24	95.9	TIR domain
8	PF13676 TIR_2	1.4e-15	69.4	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.994	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000260010	0.975	Toll-like receptor 2
3	9606.ENSP00000265077	0.965	Versican core protein
4	9606.ENSP00000358997	0.964	Interleukin-1 receptor-associated kinase 1
5	9606.ENSP00000304236	0.963	Monocyte differentiation antigen CD14
6	9606.ENSP00000354932	0.962	Toll-like receptor 1
7	9606.ENSP00000433623	0.961	TNF receptor-associated factor 6
8	9606.ENSP00000376445	0.958	Toll/interleukin-1 receptor domain-containing adapter protein
9	9606.ENSP00000483825	0.940	NF-kappa-B essential modulator
10	9606.ENSP00000359424	0.939	Inhibitor of nuclear factor kappa-B kinase subunit alpha
11	9606.ENSP00000430684	0.937	Inhibitor of nuclear factor kappa-B kinase subunit beta
12	9606.ENSP00000363089	0.918	Toll-like receptor 4
13	9606.ENSP00000297185	0.814	Stress-70 protein, mitochondrial
14	9606.ENSP00000284818	0.778	Lymphocyte antigen 96
15	9606.ENSP00000398698	0.768	Tumor necrosis factor
16	9606.ENSP00000399421	0.745	Platelet glycoprotein 4
17	9606.ENSP00000295633	0.738	Follistatin-related protein 1
18	9606.ENSP00000412237	0.722	Interleukin-10
19	9606.ENSP00000302569	0.719	C-type lectin domain family 7 member A
20	9606.ENSP00000011653	0.706	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0042277	1.000	peptide binding
GO:0005102	1.000	signaling receptor binding
GO:0046983	0.999	protein dimerization activity
GO:0042802	0.999	identical protein binding
GO:0001540	0.885	amyloid-beta binding
GO:0046982	0.870	protein heterodimerization activity
GO:0008289	0.806	lipid binding
GO:0004888	0.440	transmembrane signaling receptor activity
GO:0035325	0.402	Toll-like receptor binding
GO:0071723	0.393	lipopeptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0009605	0.993	response to external stimulus
GO:0009607	0.991	response to biotic stimulus
GO:0042221	0.990	response to chemical
GO:0048518	0.990	positive regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0009987	0.987	cellular process
GO:0044419	0.984	biological process involved in interspecies interaction between organisms
GO:0023052	0.984	signaling
GO:0048584	0.983	positive regulation of response to stimulus
GO:0002684	0.981	positive regulation of immune system process
GO:0010033	0.980	response to organic substance
GO:0019222	0.978	regulation of metabolic process
GO:0007154	0.976	cell communication
GO:0032101	0.976	regulation of response to external stimulus
GO:0051239	0.971	regulation of multicellular organismal process
GO:0051707	0.971	response to other organism
GO:0010468	0.968	regulation of gene expression
GO:0031347	0.965	regulation of defense response
GO:0032103	0.961	positive regulation of response to external stimulus
GO:0031349	0.960	positive regulation of defense response
GO:0007165	0.958	signal transduction
GO:0002833	0.957	positive regulation of response to biotic stimulus
GO:0098581	0.956	detection of external biotic stimulus
GO:0001817	0.956	regulation of cytokine production
GO:0002253	0.956	activation of immune response
GO:0002757	0.947	immune response-activating signaling pathway
GO:0002218	0.946	activation of innate immune response
GO:0031323	0.945	regulation of cellular metabolic process
GO:0032490	0.945	detection of molecule of bacterial origin
GO:0006950	0.940	response to stress
GO:0002758	0.940	innate immune response-activating signaling pathway
GO:0032677	0.939	regulation of interleukin-8 production
GO:0006952	0.925	defense response
GO:0002221	0.910	pattern recognition receptor signaling pathway
GO:0001819	0.879	positive regulation of cytokine production
GO:0080090	0.847	regulation of primary metabolic process
GO:0032757	0.844	positive regulation of interleukin-8 production
GO:0002224	0.838	toll-like receptor signaling pathway
GO:0065009	0.829	regulation of molecular function
GO:0051171	0.826	regulation of nitrogen compound metabolic process
GO:0048522	0.804	positive regulation of cellular process
GO:0009966	0.766	regulation of signal transduction
GO:0006955	0.747	immune response
GO:0009967	0.712	positive regulation of signal transduction
GO:1901700	0.683	response to oxygen-containing compound
GO:0048519	0.653	negative regulation of biological process
GO:0044093	0.631	positive regulation of molecular function
GO:0051246	0.621	regulation of protein metabolic process
GO:1902531	0.609	regulation of intracellular signal transduction
GO:0062207	0.581	regulation of pattern recognition receptor signaling pathway
GO:1902533	0.555	positive regulation of intracellular signal transduction
GO:0070887	0.537	cellular response to chemical stimulus
GO:0051173	0.537	positive regulation of nitrogen compound metabolic process
GO:0031325	0.520	positive regulation of cellular metabolic process
GO:0051247	0.517	positive regulation of protein metabolic process
GO:0071310	0.516	cellular response to organic substance
GO:0010556	0.515	regulation of macromolecule biosynthetic process
GO:2001141	0.511	regulation of RNA biosynthetic process
GO:0008152	0.498	metabolic process
GO:0006355	0.495	regulation of DNA-templated transcription
GO:0032501	0.484	multicellular organismal process
GO:0031399	0.468	regulation of protein modification process
GO:0050790	0.450	regulation of catalytic activity
GO:0001932	0.446	regulation of protein phosphorylation
GO:0051090	0.432	regulation of DNA-binding transcription factor activity
GO:0098542	0.419	defense response to other organism
GO:0051091	0.378	positive regulation of DNA-binding transcription factor activity
GO:0001775	0.375	cell activation
GO:0048523	0.370	negative regulation of cellular process
GO:0071216	0.365	cellular response to biotic stimulus
GO:0071219	0.363	cellular response to molecule of bacterial origin
GO:0042327	0.354	positive regulation of phosphorylation
GO:0006954	0.345	inflammatory response
GO:0007166	0.343	cell surface receptor signaling pathway
GO:0071704	0.330	organic substance metabolic process
GO:0009892	0.326	negative regulation of metabolic process
GO:0010605	0.321	negative regulation of macromolecule metabolic process
GO:0001934	0.315	positive regulation of protein phosphorylation
GO:1901698	0.308	response to nitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.991	endomembrane system
GO:0005737	0.982	cytoplasm
GO:0032991	0.981	protein-containing complex
GO:0043226	0.975	organelle
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0043235	0.891	receptor complex
GO:0098796	0.739	membrane protein complex
GO:0098797	0.674	plasma membrane protein complex
GO:0098802	0.496	plasma membrane signaling receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]