StarFunc result for job id Q9Y2D9

User Input

>input (606 residues)
MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYS
VLVDTKMSKPHLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVE
VNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEK
IVEKVSVTQRRTRRAASVAAATTSPTPRTTRGRRKSVEPPKRKKRATKEPKAPVQKAKCE
EKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQ
CVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCE
TCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGK
DFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRF
SNMLKAHKEKCFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPINMNPVSTLPP
RPIPHPFSHLHIHPHPHHPHHLPIPPVPHLPPPPALFKSEPLNHRGQSEDNFLRHLAEKN
SSAQHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2D9	1.000	1.000	1.951E-99	606	1.000	1.000	Q9Y2D9.pdb.gz	ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3
2	AFDB:Q16600	0.290	0.372	5.468E-26	458	0.211	0.279	Q16600.pdb.gz	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3
3	AFDB:Q8TC21	0.270	0.316	8.473E-26	504	0.162	0.194	Q8TC21.pdb.gz	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
4	AFDB:P51814	0.306	0.234	9.602E-26	821	0.213	0.157	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
5	AFDB:Q12901	0.296	0.328	1.158E-25	538	0.183	0.206	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
6	AFDB:A0A090N7U3	0.286	0.237	1.233E-25	752	0.191	0.154	A0A090N7U3.pdb.gz	A0A090N7U3_HUMAN Zinc finger protein 425 OS=Homo sapiens OX=9606 GN=LOC155054 PE=4 SV=1
7	AFDB:Q5DTF8	0.293	0.203	2.306E-25	919	0.172	0.113	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
8	AFDB:P17027	0.262	0.248	2.455E-25	643	0.177	0.166	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
9	AFDB:Q8TF45	0.284	0.259	2.782E-25	676	0.170	0.152	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
10	AFDB:Q9NQZ8	0.273	0.328	2.782E-25	489	0.180	0.223	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
11	PDB:3w5kB	0.091	0.326	4.708E-5	110	0.056	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7uhyC	0.033	0.035	3.618E-1	578	0.035	0.036	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
13	PDB:6o9lQ	0.044	0.059	3.852E-1	430	0.059	0.084	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:6ydhA	0.042	0.193	4.365E-1	62	0.020	0.194	6ydhA.pdb.gz
15	PDB:4kfzB	0.054	0.141	8.688E-1	148	0.041	0.169	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
16	PDB:4r8pL	0.040	0.082	9.249E-1	254	0.028	0.067	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
17	PDB:5dkaA	0.052	0.241	9.249E-1	96	0.030	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:6gym3	0.049	0.157	2.086	138	0.040	0.174	6gym3.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
19	PDB:4z4kA	0.052	0.099	2.221	282	0.018	0.039	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
20	PDB:6ff4t	0.041	0.115	2.221	172	0.018	0.064	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UFB7	0.0	536	747	0.416	0.337	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
2	Q9Y2D9	0.0	1256	606	1.000	1.000	ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3
3	Q02386	3.40e-51	189	682	0.165	0.147	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
4	G3V9G6	1.27e-49	186	740	0.158	0.130	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
5	A0A8I6G8Y2	1.55e-49	185	723	0.158	0.133	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
6	Q62788	1.72e-49	185	744	0.158	0.129	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
7	Q99K53	2.36e-49	184	700	0.153	0.133	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
8	Q9R164	2.82e-49	184	701	0.153	0.133	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
9	Q49A12	1.45e-48	179	536	0.165	0.187	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
10	Q9H8G1	2.42e-48	179	570	0.163	0.174	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
11	Q2NKJ9	2.93e-48	179	569	0.163	0.174	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
12	E9Q5X9	3.95e-48	178	531	0.152	0.173	E9Q5X9_MOUSE Zinc finger protein 819 OS=Mus musculus OX=10090 GN=Zfp819 PE=4 SV=1
13	Q9D5K8	4.07e-48	178	531	0.152	0.173	Q9D5K8_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp819 PE=2 SV=1
14	Q86WZ6	4.28e-48	182	799	0.153	0.116	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
15	Q9UJW7	4.94e-48	182	825	0.155	0.114	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
16	Q03923	6.35e-48	179	595	0.165	0.168	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
17	Q9NQZ8	7.35e-48	176	489	0.153	0.190	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
18	Q3V1X2	9.14e-48	181	888	0.160	0.109	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
19	Q7TPL6	9.86e-48	181	888	0.160	0.109	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1
20	Q14592	1.36e-47	177	562	0.165	0.178	ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens OX=9606 GN=ZNF460 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	0.2	23.0	Adenylate kinase, active site lid
2	PF01722 BolA	1e+02	14.7	BolA-like protein
3	PF05432 BSP_II	47	15.2	Bone sialoprotein II (BSP-II)
4	PF15748 CCSAP	49	15.3	Centriole, cilia and spindle-associated
5	PF10697 DUF2502	4e+02	12.7	Protein of unknown function (DUF2502)
6	PF00096 zf-C2H2	2e-32	120.9	Zinc finger, C2H2 type
7	PF12756 zf-C2H2_2	56	15.5	C2H2 type zinc-finger (2 copies)
8	PF13894 zf-C2H2_4	1.4e-22	89.4	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.24	22.7	C2H2-type zinc finger
10	PF15909 zf-C2H2_8	1.1e+02	14.5	C2H2-type zinc ribbon
11	PF12171 zf-C2H2_jaz	0.00078	30.9	Zinc-finger double-stranded RNA-binding
12	PF05605 zf-Di19	1.2e+02	14.4	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	5.7e-24	94.6	Zinc-finger double domain
14	PF12874 zf-met	2.6e-07	42.0	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	49	15.0	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268679	0.927	Protein CBFA2T3
2	9606.ENSP00000479636	0.756	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
3	9606.ENSP00000425421	0.751	Spermidine/spermine N1-acetyl transferase like 1
4	9606.ENSP00000244426	0.688	F-box only protein 9
5	9606.ENSP00000328698	0.683	Ciliary-associated calcium-binding coiled-coil protein 1
6	9606.ENSP00000185206	0.668	Chloride intracellular channel protein 5
7	9606.ENSP00000441980	0.635	Choline/ethanolaminephosphotransferase 1
8	9606.ENSP00000261716	0.630	Serine/threonine-protein kinase TAO1
9	9606.ENSP00000477653	0.552	Dual specificity protein phosphatase 14
10	9606.ENSP00000347883	0.541	Pleckstrin homology domain-containing family A member 7
11	9606.ENSP00000345492	0.540	SH2B adapter protein 3
12	9606.ENSP00000404151	0.500	Centrosomal protein of 170 kDa protein B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003677	0.686	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0010468	0.915	regulation of gene expression
GO:0051171	0.885	regulation of nitrogen compound metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0031323	0.857	regulation of cellular metabolic process
GO:0010556	0.856	regulation of macromolecule biosynthetic process
GO:0031326	0.852	regulation of cellular biosynthetic process
GO:0051252	0.852	regulation of RNA metabolic process
GO:0009987	0.823	cellular process
GO:2001141	0.768	regulation of RNA biosynthetic process
GO:0006355	0.686	regulation of DNA-templated transcription
GO:0048519	0.643	negative regulation of biological process
GO:0048523	0.610	negative regulation of cellular process
GO:0048518	0.530	positive regulation of biological process
GO:0032502	0.522	developmental process
GO:0010605	0.501	negative regulation of macromolecule metabolic process
GO:0032501	0.480	multicellular organismal process
GO:0031324	0.455	negative regulation of cellular metabolic process
GO:0051172	0.453	negative regulation of nitrogen compound metabolic process
GO:0048856	0.438	anatomical structure development
GO:0048522	0.431	positive regulation of cellular process
GO:0010558	0.374	negative regulation of macromolecule biosynthetic process
GO:0031327	0.364	negative regulation of cellular biosynthetic process
GO:1902679	0.346	negative regulation of RNA biosynthetic process
GO:0045892	0.344	negative regulation of DNA-templated transcription
GO:0010604	0.318	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.514	cytoplasm
GO:0016020	0.330	membrane
GO:0043232	0.311	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]