StarFunc result for job id Q9Y2E4

User Input

>input (1556 residues)
MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQ
ERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLV
VQTSMDAYTPPDTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSS
TQSGGSGAAHRLADVMAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTGSRTAPKYGNAE
LMETGDGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGA
QMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYILTYGKLWTRSM
KVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRK
DAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPP
RDWFPHIKDANNDTAYIEYKTCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVL
DFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWAL
VAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTV
AIRRPTDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDG
VPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYPFIRTGLLGF
VGPGGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERI
VIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQ
LFLEGSLHPCNVLMCPHTCVTNLPKPRQKQPEIGPASVMVGNLVSGKRIAQASGRDLGQI
EDNDQARKFLFLSEVLQWRAQTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLME
RGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPHPQNIATTLPTVKMIVEVSR
SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKRPAQICKPCNPDTLAYLDFS
VSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGH
QSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRV
RTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYV
DMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAH
NASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVV
GALDEAMELRGMRYHPIDIETSVIRAHKSVTECAVFTWTNLLVVVVELDGSEQEALDLVP
LVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14689	0.839	0.832	0.000	1571	0.751	0.744	Q14689.pdb.gz	DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A PE=1 SV=2
2	AFDB:Q9P265	0.872	0.861	0.000	1576	0.733	0.724	Q9P265.pdb.gz	DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3
3	PDB:5hm3A	0.328	0.780	3.646E-37	625	0.084	0.210	5hm3A.pdb.gz	Structure of the Essential Mtb FadD32 Enzyme: A Promising Drug Target for Treating Tuberculosis.
4	PDB:3r44A	0.254	0.715	6.862E-27	502	0.055	0.169	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
5	PDB:5ja2A	0.243	0.300	6.432E-26	1238	0.079	0.099	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
6	PDB:6q2mA	0.283	0.741	9.340E-26	544	0.055	0.158	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
7	PDB:5ie2A	0.270	0.756	9.851E-26	506	0.059	0.182	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
8	PDB:5bsmA	0.281	0.753	1.219E-25	530	0.066	0.194	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
9	PDB:7kydA	0.274	0.723	1.356E-25	534	0.062	0.182	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
10	PDB:1ultA	0.245	0.631	1.969E-25	533	0.073	0.214	1ultA.pdb.gz
11	PDB:3b7wA	0.243	0.639	7.462E-25	537	0.057	0.164	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
12	PDB:3rg2C	0.227	0.531	3.280E-23	613	0.060	0.152	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
13	AFDB:Q9FNM7	0.077	0.116	3.708E-3	850	0.066	0.121	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
14	AFDB:Q9VHP0	0.076	0.114	3.476E-2	798	0.051	0.100	Q9VHP0.pdb.gz	DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster OX=7227 GN=bel PE=1 SV=1
15	AFDB:P54132	0.056	0.059	1.913E-1	1417	0.042	0.046	P54132.pdb.gz	BLM_HUMAN RecQ-like DNA helicase BLM OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1
16	AFDB:P90897	0.072	0.102	1.913E-1	959	0.051	0.082	P90897.pdb.gz	RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans OX=6239 GN=rde-12 PE=1 SV=4
17	AFDB:Q08438	0.057	0.103	2.367E-1	674	0.049	0.113	Q08438.pdb.gz	VHS3_YEAST Phosphopantothenoylcysteine decarboxylase subunit VHS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VHS3 PE=1 SV=1
18	AFDB:P26358	0.024	0.023	2.497E-1	1616	0.028	0.027	P26358.pdb.gz	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2
19	AFDB:Q9Z330	0.026	0.025	4.991E-1	1622	0.027	0.026	Q9Z330.pdb.gz	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
20	AFDB:O88700	0.065	0.068	5.552E-1	1416	0.049	0.054	O88700.pdb.gz	BLM_MOUSE RecQ-like DNA helicase BLM OS=Mus musculus OX=10090 GN=Blm PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14689	0.0	2387	1571	0.753	0.745	DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A PE=1 SV=2
2	Q3UH60	0.0	2336	1574	0.731	0.722	DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus OX=10090 GN=Dip2b PE=1 SV=1
3	Q8BWT5	0.0	2361	1523	0.750	0.766	DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus OX=10090 GN=Dip2a PE=1 SV=3
4	Q9P265	0.0	2335	1576	0.736	0.727	DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3
5	Q9W0S9	0.0	1697	1773	0.584	0.512	DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster OX=7227 GN=DIP2 PE=1 SV=2
6	Q10250	2.96e-57	221	1517	0.144	0.148	YD22_SCHPO Uncharacterized protein C56F8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56F8.02 PE=4 SV=1
7	P95141	3.98e-33	139	619	0.098	0.247	FAA29_MYCTU 4-hydroxyphenylalkanoate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD29 PE=1 SV=1
8	Q09773	4.35e-30	132	1487	0.172	0.180	MUG62_SCHPO Meiotically up-regulated gene 62 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug62 PE=1 SV=2
9	Q7TXM1	5.69e-30	129	583	0.103	0.276	FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fadD26 PE=1 SV=1
10	P9WQ43	9.23e-30	129	583	0.103	0.276	FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD26 PE=1 SV=1
11	Q9I157	2.07e-28	127	4342	0.102	0.036	Q9I157_PSEAE PvdL OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdL PE=4 SV=1
12	P9WQ45	3.47e-28	124	583	0.094	0.250	FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD25 PE=1 SV=1
13	P9WQ57	1.80e-27	122	585	0.081	0.215	FAA30_MYCTU Probable long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD30 PE=1 SV=1
14	Q12275	2.52e-27	124	1648	0.105	0.100	YO093_YEAST Uncharacterized protein YOR093C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR093C PE=1 SV=1
15	O53580	2.62e-27	122	637	0.093	0.228	FAA32_MYCTU Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD32 PE=1 SV=1
16	P9WQ49	3.57e-26	117	578	0.093	0.249	FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD21 PE=1 SV=1
17	P9WQ59	1.40e-25	115	580	0.097	0.260	FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD28 PE=1 SV=1
18	P9WQ47	1.67e-23	109	584	0.091	0.243	FAA23_MYCTU Long-chain-fatty-acid--AMP ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD23 PE=1 SV=1
19	Q9VDU3	2.03e-11	70.9	546	0.089	0.253	Q9VDU3_DROME RE32325p OS=Drosophila melanogaster OX=7227 GN=Acsx1R PE=2 SV=2
20	Q9VDU4	7.58e-11	68.9	537	0.087	0.251	Q9VDU4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Acsx1L PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	7.3e-97	336.3	AMP-binding enzyme
2	PF06464 DMAP_binding	4.5e-33	125.8	DMAP1-binding Domain
3	PF05120 GvpG	36	15.8	Gas vesicle protein G

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282908	0.733	Serine/threonine kinase 32B
2	9606.ENSP00000283195	0.694	E3 SUMO-protein ligase RanBP2
3	9606.ENSP00000339109	0.625	Anaphase-promoting complex subunit 1
4	9606.ENSP00000370517	0.622	ATP-dependent 6-phosphofructokinase, platelet type
5	9606.ENSP00000355966	0.619	Serine/threonine-protein kinase Nek2
6	9606.ENSP00000381053	0.615	Zinc finger MYND domain-containing protein 11
7	9606.ENSP00000285083	0.585	Oxidoreductase NAD-binding domain-containing protein 1
8	9606.ENSP00000445675	0.568	Melanoma antigen preferentially expressed in tumors
9	9606.ENSP00000482767	0.563	La-related protein 4B
10	9606.ENSP00000345029	0.520	Protein FAM47A
11	9606.ENSP00000277517	0.506	Isopentenyl-diphosphate delta-isomerase 2
12	9606.ENSP00000350954	0.505	WD repeat-containing protein 37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.946	catalytic activity
GO:0016740	0.427	transferase activity
GO:0016874	0.397	ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.986	cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0048519	0.926	negative regulation of biological process
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0080090	0.849	regulation of primary metabolic process
GO:0050794	0.845	regulation of cellular process
GO:0048518	0.841	positive regulation of biological process
GO:0071704	0.729	organic substance metabolic process
GO:0044238	0.665	primary metabolic process
GO:0071840	0.656	cellular component organization or biogenesis
GO:0009893	0.601	positive regulation of metabolic process
GO:0006807	0.559	nitrogen compound metabolic process
GO:0016043	0.558	cellular component organization
GO:0051173	0.525	positive regulation of nitrogen compound metabolic process
GO:0010604	0.514	positive regulation of macromolecule metabolic process
GO:0044237	0.512	cellular metabolic process
GO:0051246	0.433	regulation of protein metabolic process
GO:1901564	0.416	organonitrogen compound metabolic process
GO:1901983	0.379	regulation of protein acetylation
GO:0051247	0.362	positive regulation of protein metabolic process
GO:0031323	0.350	regulation of cellular metabolic process
GO:0010468	0.327	regulation of gene expression
GO:0048523	0.317	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0016020	0.985	membrane
GO:0005634	0.915	nucleus
GO:0005829	0.910	cytosol
GO:0070013	0.725	intracellular organelle lumen
GO:0071944	0.635	cell periphery
GO:0031981	0.512	nuclear lumen
GO:0005654	0.486	nucleoplasm
GO:0005739	0.429	mitochondrion
GO:0120025	0.426	plasma membrane bounded cell projection
GO:0032991	0.384	protein-containing complex
GO:0005576	0.331	extracellular region
GO:0043005	0.310	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.427	Transferases.
EC:6.-.-.-	0.397	Ligases.

[back to server]