StarFunc result for job id Q9Y2E5

User Input

>input (1009 residues)
MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSV
VEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVT
HLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDL
KAAMQEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPK
PPQDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFA
NMDPLLDHINSHAAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTG
FYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDPTWALQQLQQLRWAVSEVQHH
DAITGTESPKVRDMYATHLASGMLGMRKLMASIVLDELQPQAPMAASSDAGPAGHFASVY
NPLAWTVTTIVTLTVGFPGVRVTDEAGHPVPSQIQNSTETPSAYDLLILTTIPGLSYRHY
NIRPTAGAQEGTQEPAATVASTLQFGRRLRRRTSHAGRYLVPVANDCYIVLLDQDTNLMH
SIWERQSNRTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVEMEIVAGQLV
TEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLELNREAVLRTS
TNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHG
ISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTTALRQRSAL
ALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRK
GHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWD
LSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIRTFFIHFQQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K8F6	0.951	0.956	0.000	1004	0.754	0.758	A0A0G2K8F6.pdb.gz	A0A0G2K8F6_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=2
2	AFDB:Q9Y2E5	1.000	1.000	0.000	1009	1.000	1.000	Q9Y2E5.pdb.gz	MA2B2_HUMAN Epididymis-specific alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B2 PE=1 SV=4
3	AFDB:P34098	0.815	0.814	6.868E-78	1010	0.278	0.278	P34098.pdb.gz	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
4	AFDB:O09159	0.810	0.807	6.057E-77	1013	0.283	0.282	O09159.pdb.gz	MA2B1_MOUSE Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4
5	AFDB:O00754	0.805	0.804	1.754E-76	1011	0.287	0.287	O00754.pdb.gz	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
6	AFDB:Q6P762	0.802	0.802	4.827E-76	1009	0.283	0.283	Q6P762.pdb.gz	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
7	AFDB:Q29451	0.790	0.798	7.063E-75	999	0.283	0.286	Q29451.pdb.gz	MA2B1_BOVIN Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4
8	AFDB:Q8IPB7	0.806	0.755	2.992E-73	1080	0.270	0.252	Q8IPB7.pdb.gz	Q8IPB7_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=1
9	AFDB:Q8LPJ3	0.809	0.797	3.483E-73	1024	0.272	0.268	Q8LPJ3.pdb.gz	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
10	AFDB:P94078	0.804	0.796	1.366E-72	1019	0.265	0.262	P94078.pdb.gz	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
11	PDB:3bubA	0.753	0.748	3.827E-65	1016	0.244	0.242	3bubA.pdb.gz	Probing the substrate specificity of Golgi alpha-mannosidase II by use of synthetic oligosaccharides and a catalytic nucleophile mutant.
12	PDB:6rrnA	0.770	0.785	4.026E-65	989	0.236	0.241	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
13	PDB:7vqoA	0.615	0.533	2.311E-34	1180	0.139	0.119	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
14	PDB:7dd9A	0.615	0.554	1.668E-31	1129	0.129	0.115	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	PDB:5jm0A	0.582	0.621	5.800E-24	940	0.118	0.127	5jm0A.pdb.gz
16	PDB:3p0bA	0.277	0.496	4.027E-7	511	0.063	0.125	3p0bA.pdb.gz
17	PDB:6al2A	0.149	0.274	2.558E-5	484	0.031	0.064	6al2A.pdb.gz
18	PDB:5mg3C	0.152	0.292	7.791E-5	455	0.024	0.053	5mg3C.pdb.gz
19	PDB:6drvA	0.141	0.140	2.626E-4	1024	0.032	0.031	6drvA.pdb.gz
20	PDB:3nreA	0.149	0.415	5.903E-4	291	0.030	0.103	3nreA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K8F6	0.0	1551	1021	0.744	0.736	A0A0G2K8F6_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=2
2	A0A8I6AJ32	0.0	1413	935	0.671	0.724	A0A8I6AJ32_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1
3	B5DEJ3	0.0	1542	1004	0.737	0.741	B5DEJ3_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=2 SV=1
4	O54782	0.0	1549	1018	0.759	0.752	MA2B2_MOUSE Epididymis-specific alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b2 PE=1 SV=2
5	Q7TP34	0.0	596	1449	0.289	0.202	Q7TP34_RAT Ab2-450 OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1
6	Q9Y2E5	0.0	2085	1009	1.000	1.000	MA2B2_HUMAN Epididymis-specific alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B2 PE=1 SV=4
7	P34098	1.12e-110	369	1010	0.296	0.296	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
8	Q6P762	2.47e-89	310	1009	0.292	0.292	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
9	F7FG85	1.49e-87	305	1020	0.292	0.289	F7FG85_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=1 SV=1
10	O09159	2.34e-87	304	1013	0.293	0.292	MA2B1_MOUSE Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4
11	Q8IPB7	1.49e-86	303	1080	0.285	0.267	Q8IPB7_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=1
12	O00754	2.08e-85	299	1011	0.293	0.293	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
13	Q16706	4.95e-83	294	1144	0.251	0.221	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
14	Q29451	6.70e-83	291	999	0.285	0.288	MA2B1_BOVIN Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4
15	Q9VKV1	1.10e-82	292	1080	0.279	0.261	Q9VKV1_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=2
16	Q8LPJ3	4.31e-82	290	1024	0.298	0.294	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
17	Q8BRK9	5.82e-81	288	1152	0.246	0.215	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
18	P94078	5.00e-79	281	1019	0.294	0.291	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
19	P28494	3.13e-78	280	1148	0.250	0.220	MA2A1_RAT Alpha-mannosidase 2 OS=Rattus norvegicus OX=10116 GN=Man2a1 PE=1 SV=2
20	P27046	3.44e-77	277	1150	0.249	0.218	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09261 Alpha-mann_mid	4.3e-19	79.8	Alpha mannosidase middle domain
2	PF17677 Glyco_hydro38C2	5.7e-06	37.7	Glycosyl hydrolases family 38 C-terminal beta sandwich domain
3	PF07748 Glyco_hydro_38C	3.2e-20	84.7	Glycosyl hydrolases family 38 C-terminal domain
4	PF01074 Glyco_hydro_38N	3.5e-90	313.9	Glycosyl hydrolases family 38 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457788	0.924	Alpha-mannosidase 2C1
2	9606.ENSP00000395473	0.842	Lysosomal alpha-mannosidase
3	9606.ENSP00000363452	0.705	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
4	9606.ENSP00000263593	0.697	Sialate O-acetylesterase
5	9606.ENSP00000256497	0.645	ER degradation-enhancing alpha-mannosidase-like protein 1
6	9606.ENSP00000363603	0.643	Tissue alpha-L-fucosidase
7	9606.ENSP00000286733	0.636	N-acylethanolamine-hydrolyzing acid amidase
8	9606.ENSP00000326699	0.636	Calmegin
9	9606.ENSP00000299314	0.629	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
10	9606.ENSP00000306920	0.629	Beta-galactosidase
11	9606.ENSP00000226578	0.620	Beta-mannosidase
12	9606.ENSP00000335083	0.614	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
13	9606.ENSP00000365938	0.592	UDP-glucose:glycoprotein glucosyltransferase 2
14	9606.ENSP00000260116	0.546	Alpha-tocopherol transfer protein
15	9606.ENSP00000318165	0.544	Protein OS-9
16	9606.ENSP00000002165	0.539	Plasma alpha-L-fucosidase
17	9606.ENSP00000302728	0.516	Beta-glucuronidase
18	9606.ENSP00000185150	0.507	Endoplasmic reticulum lectin 1
19	9606.ENSP00000357453	0.505	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004559	1.000	alpha-mannosidase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0005975	0.980	carbohydrate metabolic process
GO:0019318	0.820	hexose metabolic process
GO:1901575	0.398	organic substance catabolic process
GO:0006013	0.362	mannose metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	0.999	lysosome
GO:0070013	0.994	intracellular organelle lumen
GO:0005576	0.956	extracellular region
GO:0012505	0.953	endomembrane system
GO:0070062	0.915	extracellular exosome
GO:0005775	0.714	vacuolar lumen
GO:0016020	0.699	membrane
GO:0043202	0.366	lysosomal lumen
GO:0031410	0.350	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.24	1.000	alpha-mannosidase.

[back to server]