StarFunc result for job id Q9Y2F5

User Input

>input (2266 residues)
MMPGETHSAAPGTAADLSRCQGCASLQQNLNEYVEALITLKQKIINTDNLLTEYQKKCDE
LQFARRENSNLHHQVEEMLQKISPLQKCQEELGSLKAELEEKKSSLKLYQDTHQEYARVK
EECLKSDAQKKKLEAKVKKLQEAAVKQTQDFKQLRNEKKILEKEFKKTQERLDEFSKQKN
EKELRHIGTQISSDSYGSIDKRKVKLLLKELWLCVNTTHRLPGEGSRCVPEKPAKAITSS
RVPGEDGTLPPTQGSPLRTSNVQTCLTKLSMEIKEDFLCQNVEKQSSSGTNCSSDHVFNE
NGNLEVLVQSHRDGGSTEFVDHDHFFDEDLQAAIDFFKLPPPLLSPVPSPPPMSSPHPGS
LPSSFAPETYFGEYTDSSDNDSVQLRNSAECVSEDDTTESQNYFGSLRKNKGSGTWEEKP
KSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILH
ETKTQMEVREMDKSVQTEKTIHKLTRGLCIERLSASPAQEKEAAPGKSELCSSPLGKRPL
NELMESEGKTVLSKMMGSPKSEFTKWTRINEITSEPDRITVSGHFHRLSRELEKEKEDTQ
GFTLGESPESEDDDSGDGMDVAGLDIETSFSSSSTLVALSVGSNPQSSSGLDCGNDTDIT
TKVFSTEPHHSEHKLQTKTLNTLHLQSEPPECSIGGNNLENSLCALSPELGASNFNDQKS
SGIEYTKVVKGLTKIHSLPRSVFMKATKDGQCESQDPRIELTLNKPDFTSLIGSQAALIK
SGLGFVKSTSWHHSDLLRKGGEESLRAKSEHEQKTSHQLQKAMPFLQNRGPTPKPDLLRE
NNNPVEFKTTASVLPNQVSVITKQTRPEKVQSAKLEHLRPHRVEPTLVTENSGNKTGMST
VAKCDGERDDTTQNITEVAAVKSISPEVSASRRKLDFNSPGGSSPVENSDCSTNSRLSFS
PENILIQNQDIVREAAVQGDGQKQRQPQATDLDSSGTHGSEMLPATEVTVSGGFSVEETS
CGDTGRSGGEALAVANDSTSTPQNANGLWKLKSTTPGGALPECFGTTDTTFSSAFCRKHG
ETQDTSQSSLPGTLHCYTGIREGGDDTEVESEAFSCSEGSEQQDAPDDSQKNLGDTDAAV
AEVRPSLEVGYLTSALQDFNISTFSELDRLSTSEVVMFLESCQLGDYSSGDSVSECSSKG
TLSKEMNKELKASEIGEKYRKQPCEEETLGTCEEWIESEEDDYSLKNTSQLTQCSLETLS
EVLTKIRQELQTNSEDCNGKDTGSLLLLNVNNNMTTENLKEKSPFRETTGSSSHASEPTP
QAAALDTEGSSPISGMPQNENPQSRPEARSDAGRQTDGGEEDLPEPVEPSALCSDSVMEP
SIEQSSNCEAETTFQCQIATVTSEVINVLINKDQNLVIEKGDNWTIISGVAVLPHVDQVT
LCDIPGDIPISQDQGELEAGCIPVTSAEKSPEASHTGPAFQEAPCGNNLSCPQEDVSSSG
QSTNFDKSRLRNRPVKPSIWISSQIYDQNFETQIVASDHTYYNSKLEPSGKNKNRSKISN
KDQSNKPVKTSASSRVETHQSEVAQSFSGEKANTKTQRSQTQTILANADTSTPTDCSPDT
LSKIRQEVGPPLPPLLAPLIATPPRTSQPLSPLISSSSPSSPASPVGQVSPFRETPVPPA
MSPWPEDPRRASPPDPSPSPSAASASERVVPSPLQFCAATPKHALPVPGRLPPCASGHAA
VGGPQENSVKILDTMYPELSARARTLNILKGNIQLTRGPPADCKNLPGPASAMIGFKTIT
SAATAFVKTGSSSGGDCNQDKSRDLGTQQDSSGKRTLSTSTLRSAKRLRLDTGSPEPETR
GVTAEGIHKNLPGNLPPAEVATTNEERSCSSPAVSAVSQLPLSPKETVESHDKAIANALK
KIAEFSFDLLPVIRSHVYVGNISKKPVMRDQEKEVVYEFSTTKKHLAECLLHSILSELKI
QKISMDHNYIHALCRVYVGICRQLGDLERARLFCYSLLKEDFPESEKLTLFIANMWHDIF
LSQSVINKAMQLVARQRAKGEVLNCLRAFLNWEKNAPVDVGFMVSKLLLTIQLCPKTEFQ
PSEKFGEDLSDNTWEYIFAIDLLCCHQKWIWTHDNIISKELWPVMDKWIKYRKGHANIAY
TPDIIIASILRLIGRLGQLGLKEGFPSAVKNISSVIGMFIQHAHDEDIPWGIQLAAVYAL
CDLSPSNPAEISKILEAWRREASKSVPSAIVSCLEEVSALSTEELG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2F5	1.000	1.000	0.000	2266	1.000	1.000	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
2	AFDB:Q5H9R4	0.063	0.063	8.496E-5	2290	0.119	0.117	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
3	AFDB:Q9VCH1	0.052	0.055	1.476E-4	2072	0.108	0.118	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
4	AFDB:E9Q4N7	0.056	0.057	2.564E-4	2244	0.129	0.131	E9Q4N7.pdb.gz	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
5	AFDB:F1LNP1	0.052	0.063	3.465E-4	1751	0.108	0.140	F1LNP1.pdb.gz	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
6	AFDB:M9PGK7	0.035	0.035	3.643E-4	2272	0.120	0.120	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
7	AFDB:E5FYH1	0.064	0.080	3.830E-4	1653	0.101	0.138	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
8	AFDB:E7FF48	0.037	0.037	3.830E-4	2315	0.137	0.134	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
9	AFDB:G0SAK3	0.041	0.047	3.830E-4	1793	0.109	0.137	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1
10	AFDB:O14497	0.062	0.061	7.356E-4	2285	0.129	0.128	O14497.pdb.gz	ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3
11	PDB:7ni5A	0.051	0.045	3.091E-3	2791	0.021	0.017	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
12	PDB:6bq1B	0.054	0.109	1.703E-2	728	0.027	0.084	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
13	PDB:7cunG	0.062	0.112	1.980E-2	895	0.027	0.068	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
14	PDB:7sn8D	0.062	0.217	2.302E-2	399	0.018	0.103	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
15	PDB:4n5cE	0.050	0.103	7.680E-2	727	0.024	0.074	4n5cE.pdb.gz
16	PDB:6ntsB	0.062	0.281	8.491E-2	361	0.020	0.125	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
17	PDB:7pntV	0.047	0.172	9.871E-2	365	0.021	0.129	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:1b3uA	0.060	0.191	1.091E-1	588	0.023	0.090	1b3uA.pdb.gz
19	PDB:5yu7A	0.068	0.111	1.091E-1	1118	0.023	0.046	5yu7A.pdb.gz
20	PDB:6gx9A	0.062	0.113	1.091E-1	912	0.024	0.059	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2F5	0.0	4668	2266	1.000	1.000	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
2	Q9QXL1	0.015	43.1	1668	0.023	0.031	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
3	O75037	0.016	43.1	1637	0.023	0.031	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
4	A0A0A6YYJ5	0.027	42.4	1668	0.014	0.019	A0A0A6YYJ5_HUMAN Microtubule actin crosslinking factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=2
5	Q8N960	0.051	41.2	986	0.019	0.044	CE120_HUMAN Centrosomal protein of 120 kDa OS=Homo sapiens OX=9606 GN=CEP120 PE=1 SV=2
6	Q20398	0.094	40.4	1084	0.014	0.030	Q20398_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magu-4 PE=1 SV=2
7	P28023	0.16	39.7	1280	0.018	0.032	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
8	Q9M150	0.33	38.5	554	0.017	0.070	Q9M150_ARATH Uncharacterized protein AT4g01180 OS=Arabidopsis thaliana OX=3702 GN=At4g01180 PE=1 SV=1
9	Q5JR59	0.50	38.1	1369	0.017	0.028	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
10	Q5TZA2	0.54	38.1	2017	0.013	0.015	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
11	Q5T1M5	0.56	38.1	1219	0.021	0.039	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2
12	A0A087WW81	0.64	37.7	838	0.013	0.036	A0A087WW81_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=6
13	B1AKD8	0.73	37.7	1311	0.013	0.023	B1AKD8_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
14	O08788	1.1	37.0	1281	0.018	0.031	DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3
15	Q14203	1.1	37.0	1278	0.018	0.031	DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3
16	E7EX90	1.2	37.0	1256	0.018	0.032	E7EX90_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=1
17	Q9GZM8	1.3	36.2	345	0.038	0.252	NDEL1_HUMAN Nuclear distribution protein nudE-like 1 OS=Homo sapiens OX=9606 GN=NDEL1 PE=1 SV=1
18	O54874	1.4	36.6	1732	0.011	0.015	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
19	Q9UBC2	1.7	36.2	864	0.014	0.037	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
20	Q7TT49	2.0	36.2	1713	0.019	0.025	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06009 Laminin_II	6.1	18.3	Laminin Domain II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296564

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261520	0.988	Little elongation complex subunit 2
2	9606.ENSP00000262809	0.979	RNA polymerase II elongation factor ELL
3	9606.ENSP00000386488	0.948	Zinc finger CCCH domain-containing protein 8
4	9606.ENSP00000320346	0.943	RNA polymerase II elongation factor ELL3
5	9606.ENSP00000380054	0.861	ELL-associated factor 1
6	9606.ENSP00000255304	0.829	SUMO-specific isopeptidase USPL1
7	9606.ENSP00000237853	0.791	RNA polymerase II elongation factor ELL2
8	9606.ENSP00000381064	0.743	Integrator complex subunit 10
9	9606.ENSP00000331214	0.705	Small integral membrane protein 23
10	9606.ENSP00000434466	0.695	Integrator complex subunit 4
11	9606.ENSP00000429065	0.692	Integrator complex subunit 9
12	9606.ENSP00000415433	0.668	Integrator complex subunit 12
13	9606.ENSP00000261191	0.644	Integrator complex subunit 13
14	9606.ENSP00000395461	0.628	BTB/POZ domain-containing protein 19
15	9606.ENSP00000414237	0.627	Integrator complex subunit 2
16	9606.ENSP00000370625	0.623	DNA-directed RNA polymerase II subunit RPB2
17	9606.ENSP00000385722	0.622	Integrator complex subunit 1
18	9606.ENSP00000355961	0.620	Integrator complex subunit 7
19	9606.ENSP00000387006	0.620	Pre-mRNA-splicing factor CWC22 homolog
20	9606.ENSP00000156471	0.618	Intron-binding protein aquarius

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.987	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0071704	0.976	organic substance metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0044238	0.974	primary metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0043170	0.966	macromolecule metabolic process
GO:0010468	0.958	regulation of gene expression
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0010467	0.957	gene expression
GO:0016070	0.956	RNA metabolic process
GO:0016073	0.954	snRNA metabolic process
GO:0006351	0.949	DNA-templated transcription
GO:0051252	0.946	regulation of RNA metabolic process
GO:0010556	0.944	regulation of macromolecule biosynthetic process
GO:0031326	0.944	regulation of cellular biosynthetic process
GO:0048518	0.921	positive regulation of biological process
GO:0006366	0.895	transcription by RNA polymerase II
GO:0048522	0.820	positive regulation of cellular process
GO:0051173	0.795	positive regulation of nitrogen compound metabolic process
GO:0010604	0.795	positive regulation of macromolecule metabolic process
GO:0031325	0.736	positive regulation of cellular metabolic process
GO:0006355	0.645	regulation of DNA-templated transcription
GO:0010557	0.446	positive regulation of macromolecule biosynthetic process
GO:0045935	0.443	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.442	positive regulation of cellular biosynthetic process
GO:0051254	0.420	positive regulation of RNA metabolic process
GO:0009301	0.359	snRNA transcription
GO:0006383	0.302	transcription by RNA polymerase III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.997	nuclear protein-containing complex
GO:0005694	0.996	chromosome
GO:0016604	0.995	nuclear body
GO:0015030	0.991	Cajal body
GO:0008023	0.989	transcription elongation factor complex
GO:0000791	0.986	euchromatin
GO:0005737	0.882	cytoplasm
GO:0035363	0.762	histone locus body
GO:0005829	0.465	cytosol
GO:0012505	0.335	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]