StarFunc result for job id Q9Y2G1

User Input

>input (1151 residues)
MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYS
HGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLNCNNNNGMGAAPKPFPGGTGP
PIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETLCHVGVPSRLEHPPP
PPAHLPGPPPPPPPPPHYPVLQRDLYMKAEPPIPHYAAMGQGLVPTDLHHTQQSQMLHQL
LQQHGAELPTHPSKKRKHSESPPSTLNAQMLNGMIKQEPGTVTALPLHPTRAPSPPWPPQ
GPLSPGPGSLPLSIARVQTPPWHPPGAPSPGLLQDSDSLSGSYLDPNYQSIKWQPHQQNK
WATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTP
EGLKPLDCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLH
FSETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESD
SDVLWQRAQVPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDT
TEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEILPEAVKDTGDMVFANG
KTIENFLVVNKERIFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGS
SGAFSHAGSQFSRAGSVPHKKRPPKVASKSSSVVPDQACISQRFLQGTIIALVVVMAFSV
VSMSTLYVLSLRTEEDLVDTDGSFAVSTSCLLALLRPQPPGGSEALCPWSSQSFGTTQLR
QSPLTTGLPGIQPSLLLVTTSLTSSAPGSAVRTLDMCSSHPCPVICCSSPTTNPTTGPSL
GPSFNPGHVLSPSPSPSTNRSGPSQMALLPVTNIRAKSWGLSVNGIGHSKHHKSLEPLAS
PAVPFPGGQGKAKNSPSLGFHGRARRGALQSSVGPAEPTWAQGQSASLLAEPVPSLTSIQ
VLENSMSITSQYCAPGDACRPGNFTYHIPVSSGTPLHLSLTLQMNSSSPVSVVLCSLRSK
EEPCEEGSLPQSLHTHQDTQGTSHRWPITILSFREFTYHFRVALLGQANCSSEALAQPAT
DYHFHFYRLCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UR85	0.651	0.658	0.000	1138	0.887	0.897	Q3UR85.pdb.gz	MYRF_MOUSE Myelin regulatory factor OS=Mus musculus OX=10090 GN=Myrf PE=1 SV=2
2	AFDB:Q9Y2G1	1.000	1.000	0.000	1151	1.000	1.000	Q9Y2G1.pdb.gz	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
3	AFDB:G5EFI7	0.253	0.304	6.267E-54	931	0.227	0.280	G5EFI7.pdb.gz	MYRF1_CAEEL Myelin regulatory factor homolog 1 OS=Caenorhabditis elegans OX=6239 GN=myrf-1 PE=1 SV=1
4	AFDB:Q7YU08	0.055	0.066	1.235E-5	865	0.111	0.148	Q7YU08.pdb.gz	Q7YU08_DROME LD15974p OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=2 SV=1
5	AFDB:O62203	0.032	0.034	5.280E-5	1073	0.133	0.143	O62203.pdb.gz	PHM2_CAEEL Pharyngeal muscle protein 2 OS=Caenorhabditis elegans OX=6239 GN=phm-2 PE=1 SV=3
6	AFDB:Q15424	0.046	0.057	1.390E-4	915	0.102	0.128	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
7	AFDB:E9Q8E3	0.057	0.067	2.257E-4	909	0.107	0.135	E9Q8E3.pdb.gz	E9Q8E3_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
8	PDB:3gd1E	0.086	0.281	6.464E-4	300	0.017	0.067	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
9	PDB:3gc3A	0.091	0.262	6.821E-4	329	0.014	0.049	3gc3A.pdb.gz
10	AFDB:Q54NE5	0.074	0.048	8.661E-4	1918	0.124	0.075	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
11	AFDB:A2RUW2	0.059	0.088	1.196E-3	689	0.095	0.158	A2RUW2.pdb.gz
12	PDB:2agcA	0.068	0.280	1.233E-3	162	0.017	0.117	2agcA.pdb.gz
13	PDB:5w0pC	0.084	0.109	1.373E-3	850	0.014	0.019	5w0pC.pdb.gz
14	PDB:5f0jB	0.082	0.249	2.481E-3	306	0.015	0.056	5f0jB.pdb.gz
15	PDB:5nalB	0.066	0.275	2.481E-3	150	0.017	0.127	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
16	PDB:7jsmB	0.093	0.233	2.481E-3	383	0.019	0.057	7jsmB.pdb.gz
17	AFDB:Q4WXZ7	0.040	0.051	3.508E-3	772	0.116	0.172	Q4WXZ7.pdb.gz	Q4WXZ7_ASPFU C2H2 transcription factor (Swi5), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G11250 PE=4 SV=1
18	PDB:2ag2A	0.075	0.302	3.616E-3	164	0.017	0.122	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
19	PDB:1ddtA	0.064	0.110	4.484E-3	523	0.022	0.048	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
20	PDB:2e31A	0.045	0.139	5.868E-3	246	0.012	0.057	2e31A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UR85	0.0	1976	1138	0.890	0.900	MYRF_MOUSE Myelin regulatory factor OS=Mus musculus OX=10090 GN=Myrf PE=1 SV=2
2	Q9Y2G1	0.0	2357	1151	1.000	1.000	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
3	G5EFI7	4.53e-85	299	931	0.161	0.199	MYRF1_CAEEL Myelin regulatory factor homolog 1 OS=Caenorhabditis elegans OX=6239 GN=myrf-1 PE=1 SV=1
4	D9PTN5	1.02e-79	285	1009	0.154	0.175	MYRF2_CAEEL Myelin regulatory factor homolog 2 OS=Caenorhabditis elegans OX=6239 GN=myrf-2 PE=1 SV=1
5	Q54PT9	9.92e-26	117	932	0.048	0.059	MRFA_DICDI Myelin gene regulatory factor-like A OS=Dictyostelium discoideum OX=44689 GN=mrfA PE=1 SV=1
6	B2RX14	2.4	35.0	1644	0.018	0.013	TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13888 MRF_C2	8.7e-37	137.6	Myelin gene regulatory factor C-terminal domain 2
2	PF13887 MYRF_ICA	1.8e-19	79.9	Myelin regulatory factor ICA domain
3	PF05224 NDT80_PhoG	6e-25	100.1	NDT80 / PhoG like DNA-binding family
4	PF13884 Peptidase_S74	9.3e-10	50.0	Chaperone of endosialidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278836

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380093	0.855	Transcription factor SOX-10
2	9606.ENSP00000399709	0.768	Bestrophin-1
3	9606.ENSP00000481006	0.757	Myelin proteolipid protein
4	9606.ENSP00000331040	0.749	Oligodendrocyte transcription factor 2
5	9606.ENSP00000371785	0.745	Oligodendrocyte transcription factor 1
6	9606.ENSP00000305480	0.722	Flap endonuclease 1
7	9606.ENSP00000366347	0.636	Homeobox protein Nkx-2.2
8	9606.ENSP00000296741	0.629	Ectonucleotide pyrophosphatase/phosphodiesterase family member 6
9	9606.ENSP00000312293	0.614	Myelin-associated oligodendrocyte basic protein
10	9606.ENSP00000380958	0.613	Myelin basic protein
11	9606.ENSP00000463245	0.602	Functions as a negative regulator of MYRF in oligodendrocyte differentiation and myelination. Interacts with the C-terminal of MYRF inhibiting MYRF self-cleavage and N-fragment nuclear translocation. The secreted form promotes differentiation of T helper 1 cells (Th1).
12	9606.ENSP00000326170	0.601	E3 ubiquitin-protein ligase rififylin
13	9606.ENSP00000357581	0.598	Homeobox protein Nkx-6.2
14	9606.ENSP00000347748	0.583	Transmembrane protein adipocyte associated 1
15	9606.ENSP00000442982	0.576	Uracil nucleotide/cysteinyl leukotriene receptor
16	9606.ENSP00000261332	0.564	Zinc finger protein 24
17	9606.ENSP00000278829	0.558	Acts as a methyl-end fatty acyl coenzyme A (CoA) desaturase that introduces a cis double bond between the preexisting double bond and the terminal methyl group of the fatty acyl chain. Desaturates (11E)-octadecenoate (trans-vaccenoate) at carbon 13 to generate (11E,13Z)-octadecadienoate, likely participating in the biohydrogenation pathway of linoleic acid (LA) (18:2n-6).
18	9606.ENSP00000219368	0.530	Fatty acid 2-hydroxylase
19	9606.ENSP00000376048	0.530	Myelin-associated glycoprotein
20	9606.ENSP00000356275	0.526	Cysteine and glycine-rich protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0140110	0.997	transcription regulator activity
GO:0097159	0.975	organic cyclic compound binding
GO:0003676	0.969	nucleic acid binding
GO:0003700	0.948	DNA-binding transcription factor activity
GO:0003677	0.944	DNA binding
GO:0000981	0.368	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0032502	0.961	developmental process
GO:0032501	0.960	multicellular organismal process
GO:0048856	0.953	anatomical structure development
GO:0008152	0.945	metabolic process
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.932	primary metabolic process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0048522	0.898	positive regulation of cellular process
GO:0007275	0.890	multicellular organism development
GO:0019222	0.888	regulation of metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0060255	0.880	regulation of macromolecule metabolic process
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0048731	0.842	system development
GO:0031323	0.842	regulation of cellular metabolic process
GO:0009893	0.810	positive regulation of metabolic process
GO:0010468	0.798	regulation of gene expression
GO:0019219	0.779	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:2001141	0.750	regulation of RNA biosynthetic process
GO:0010604	0.741	positive regulation of macromolecule metabolic process
GO:0031325	0.739	positive regulation of cellular metabolic process
GO:0006355	0.733	regulation of DNA-templated transcription
GO:0043170	0.712	macromolecule metabolic process
GO:0007399	0.694	nervous system development
GO:0045893	0.676	positive regulation of DNA-templated transcription
GO:0071840	0.667	cellular component organization or biogenesis
GO:0016043	0.644	cellular component organization
GO:0006357	0.552	regulation of transcription by RNA polymerase II
GO:1901564	0.494	organonitrogen compound metabolic process
GO:0007417	0.481	central nervous system development
GO:0019538	0.433	protein metabolic process
GO:0051239	0.400	regulation of multicellular organismal process
GO:0016540	0.356	protein autoprocessing
GO:0030154	0.355	cell differentiation
GO:0048468	0.301	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0016020	0.992	membrane
GO:0005829	0.953	cytosol
GO:0031090	0.675	organelle membrane
GO:0031984	0.545	organelle subcompartment
GO:0005789	0.539	endoplasmic reticulum membrane
GO:0005794	0.491	Golgi apparatus
GO:0032991	0.330	protein-containing complex
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]