StarFunc result for job id Q9Y2G2

User Input

>input (537 residues)
MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFF
QAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSE
EQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRY
SVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAE
PEEAVAEIHLPHFISLQAGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMG
ILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQ
TSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITE
KRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEV
LTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2G2	1.000	1.000	2.072E-103	537	1.000	1.000	Q9Y2G2.pdb.gz	CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CARD8 PE=1 SV=2
2	AFDB:Q2LKW6	0.526	0.252	6.709E-46	1233	0.313	0.136	Q2LKW6.pdb.gz	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
3	AFDB:D9I2F9	0.503	0.227	1.454E-45	1218	0.339	0.149	D9I2F9.pdb.gz	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
4	AFDB:Q2LKU9	0.498	0.232	1.454E-45	1182	0.328	0.149	Q2LKU9.pdb.gz	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
5	AFDB:A1Z198	0.499	0.232	1.951E-44	1177	0.309	0.141	A1Z198.pdb.gz	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
6	AFDB:Q9C000	0.537	0.214	3.207E-44	1473	0.343	0.125	Q9C000.pdb.gz	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
7	AFDB:Q0GKD5	0.499	0.228	1.842E-41	1196	0.313	0.140	Q0GKD5.pdb.gz	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
8	PDB:7crwA	0.486	0.907	3.606E-34	279	0.266	0.513	7crwA.pdb.gz
9	PDB:7jkqB	0.361	0.669	2.026E-26	272	0.371	0.732	7jkqB.pdb.gz
10	PDB:6x6cF	0.230	0.851	1.579E-12	138	0.117	0.457	6x6cF.pdb.gz	DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation.
11	PDB:6x6cE	0.234	0.876	1.386E-10	134	0.138	0.552	6x6cE.pdb.gz	DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation.
12	PDB:4ikmA	0.161	0.187	6.511E-10	463	0.160	0.186	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
13	AFDB:Q80T23	0.105	0.082	1.387E-4	753	0.095	0.068	Q80T23.pdb.gz	SYTL5_MOUSE Synaptotagmin-like protein 5 OS=Mus musculus OX=10090 GN=Sytl5 PE=1 SV=1
14	AFDB:Q9HCH5	0.113	0.071	2.547E-4	934	0.112	0.064	Q9HCH5.pdb.gz	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3
15	AFDB:Q9R0Q1	0.105	0.087	6.514E-4	673	0.102	0.082	Q9R0Q1.pdb.gz	SYTL4_MOUSE Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1
16	PDB:6mksA	0.153	0.879	1.190E-3	90	0.052	0.311	6mksA.pdb.gz
17	PDB:4irlB	0.153	0.177	4.483E-3	463	0.034	0.039	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
18	PDB:6ki0A	0.147	0.171	1.212E-2	459	0.045	0.052	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
19	PDB:1dgnA	0.140	0.787	2.775E-2	89	0.035	0.213	1dgnA.pdb.gz
20	PDB:3besR	0.118	0.214	3.275E-2	250	0.024	0.052	3besR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2G2	0.0	1107	537	1.000	1.000	CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CARD8 PE=1 SV=2
2	Q9C000	1.19e-93	314	1473	0.318	0.116	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
3	Q2LKU9	3.72e-91	305	1182	0.328	0.149	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
4	D9I2G3	1.14e-89	301	1218	0.320	0.141	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
5	D9I2G4	1.17e-89	301	1218	0.320	0.141	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
6	D9I2F9	1.23e-89	301	1218	0.320	0.141	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
7	D9I2G1	1.49e-89	301	1218	0.320	0.141	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
8	D9I2H0	1.52e-89	300	1218	0.320	0.141	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
9	Q2LKV5	3.56e-83	282	1172	0.307	0.141	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
10	A1Z198	2.42e-81	277	1177	0.300	0.137	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
11	Q2LKW6	4.08e-81	277	1233	0.300	0.131	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
12	Q0GKD5	6.95e-80	273	1196	0.309	0.139	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
13	Q2LKV2	5.29e-18	90.1	906	0.097	0.057	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
14	B0V1H3	1.64e-12	72.0	478	0.158	0.178	B0V1H3_DANRE CARD-like protein OS=Danio rerio OX=7955 GN=Gene2604 PE=2 SV=1
15	A0A060XPX2	4.27e-04	45.1	353	0.048	0.074	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
16	Q8CHK8	0.003	41.6	193	0.058	0.161	Q8CHK8_RAT Apoptosis-associated speck-like protein OS=Rattus norvegicus OX=10116 GN=Pycard PE=2 SV=1
17	Q9NPP4	0.004	42.7	1024	0.052	0.027	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
18	Q3UP24	0.013	40.8	1024	0.048	0.025	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
19	Q5XLA6	0.015	37.7	110	0.050	0.245	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
20	Q5EG05	0.019	38.9	197	0.047	0.127	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	4.3e-16	70.0	Caspase recruitment domain
2	PF13553 FIIND	1.6e-92	321.1	Function to find

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.996	Caspase-1
2	9606.ENSP00000337383	0.994	NACHT, LRR and PYD domains-containing protein 3
3	9606.ENSP00000376849	0.979	Caspase-5
4	9606.ENSP00000247470	0.974	Apoptosis-associated speck-like protein containing a CARD
5	9606.ENSP00000448165	0.963	Apoptotic protease-activating factor 1
6	9606.ENSP00000357112	0.939	Interferon-inducible protein AIM2
7	9606.ENSP00000330237	0.922	Caspase-9
8	9606.ENSP00000307786	0.917	Cytochrome c
9	9606.ENSP00000331857	0.917	NACHT, LRR and PYD domains-containing protein 9
10	9606.ENSP00000478516	0.912	NACHT, LRR and PYD domains-containing protein 1
11	9606.ENSP00000225296	0.900	Putative ATP-dependent RNA helicase DHX33
12	9606.ENSP00000385090	0.875	NLR family CARD domain-containing protein 4
13	9606.ENSP00000483825	0.862	NF-kappa-B essential modulator
14	9606.ENSP00000433209	0.807	Gasdermin-D
15	9606.ENSP00000445135	0.771	NACHT, LRR and PYD domains-containing protein 2
16	9606.ENSP00000428657	0.728	Baculoviral IAP repeat-containing protein 1
17	9606.ENSP00000382840	0.724	ATP-dependent RNA helicase DDX3X
18	9606.ENSP00000309767	0.706	NACHT, LRR and PYD domains-containing protein 6
19	9606.ENSP00000254691	0.700	Caspase recruitment domain-containing protein 6
20	9606.ENSP00000300589	0.671	Nucleotide-binding oligomerization domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043028	0.999	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0042803	0.999	protein homodimerization activity
GO:0016505	0.999	peptidase activator activity involved in apoptotic process
GO:0019904	0.998	protein domain specific binding
GO:0004175	0.998	endopeptidase activity
GO:0043621	0.997	protein self-association
GO:0038187	0.995	pattern recognition receptor activity
GO:0061133	0.995	endopeptidase activator activity
GO:0008656	0.994	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0140608	0.867	cysteine-type endopeptidase activator activity
GO:0050700	0.750	CARD domain binding
GO:0032089	0.665	NACHT domain binding
GO:0019899	0.581	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048585	0.992	negative regulation of response to stimulus
GO:0009607	0.989	response to biotic stimulus
GO:0006950	0.988	response to stress
GO:0032731	0.988	positive regulation of interleukin-1 beta production
GO:0044419	0.987	biological process involved in interspecies interaction between organisms
GO:0009987	0.987	cellular process
GO:0009605	0.987	response to external stimulus
GO:0044092	0.986	negative regulation of molecular function
GO:0043280	0.985	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043122	0.984	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955	0.981	immune response
GO:0098542	0.980	defense response to other organism
GO:0051090	0.980	regulation of DNA-binding transcription factor activity
GO:0009968	0.979	negative regulation of signal transduction
GO:0009892	0.975	negative regulation of metabolic process
GO:0071704	0.973	organic substance metabolic process
GO:0008219	0.973	cell death
GO:0044238	0.969	primary metabolic process
GO:0060759	0.967	regulation of response to cytokine stimulus
GO:0012501	0.964	programmed cell death
GO:0010605	0.962	negative regulation of macromolecule metabolic process
GO:0001959	0.959	regulation of cytokine-mediated signaling pathway
GO:0019538	0.957	protein metabolic process
GO:0071840	0.945	cellular component organization or biogenesis
GO:0009615	0.945	response to virus
GO:0016043	0.944	cellular component organization
GO:0045087	0.940	innate immune response
GO:0010803	0.938	regulation of tumor necrosis factor-mediated signaling pathway
GO:0043433	0.929	negative regulation of DNA-binding transcription factor activity
GO:0060761	0.925	negative regulation of response to cytokine stimulus
GO:0032101	0.922	regulation of response to external stimulus
GO:0043086	0.922	negative regulation of catalytic activity
GO:0051248	0.909	negative regulation of protein metabolic process
GO:0051241	0.900	negative regulation of multicellular organismal process
GO:0010629	0.899	negative regulation of gene expression
GO:0140546	0.891	defense response to symbiont
GO:0001818	0.888	negative regulation of cytokine production
GO:0032088	0.885	negative regulation of NF-kappaB transcription factor activity
GO:0043933	0.883	protein-containing complex organization
GO:0010466	0.879	negative regulation of peptidase activity
GO:0010951	0.869	negative regulation of endopeptidase activity
GO:0051607	0.865	defense response to virus
GO:0070613	0.857	regulation of protein processing
GO:0006508	0.856	proteolysis
GO:0022607	0.844	cellular component assembly
GO:0032692	0.831	negative regulation of interleukin-1 production
GO:0001960	0.830	negative regulation of cytokine-mediated signaling pathway
GO:0010955	0.825	negative regulation of protein processing
GO:0043124	0.810	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051128	0.808	regulation of cellular component organization
GO:0065003	0.807	protein-containing complex assembly
GO:0140374	0.793	antiviral innate immune response
GO:0044087	0.777	regulation of cellular component biogenesis
GO:0051129	0.693	negative regulation of cellular component organization
GO:0048522	0.645	positive regulation of cellular process
GO:0051260	0.519	protein homooligomerization
GO:0080134	0.494	regulation of response to stress
GO:0051716	0.485	cellular response to stimulus
GO:0010941	0.461	regulation of cell death
GO:0031347	0.445	regulation of defense response
GO:0070269	0.374	pyroptosis
GO:0048584	0.369	positive regulation of response to stimulus
GO:0006915	0.347	apoptotic process
GO:0009967	0.342	positive regulation of signal transduction
GO:0043067	0.324	regulation of programmed cell death
GO:0140632	0.314	inflammasome complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0061702	0.992	inflammasome complex
GO:0072559	0.602	NLRP3 inflammasome complex
GO:0140634	0.468	CARD8 inflammasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).

[back to server]