StarFunc result for job id Q9Y2G3

User Input

>input (1177 residues)
MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLF
EQFRRVANFYFLIIFLVQLMIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHNSDNEVN
GAPVYVVRSGGLVKTRSKNIRVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGE
TNLKTHVAVPETALLQTVANLDTLVAVIECQQPEADLYRFMGRMIITQQMEEIVRPLGPE
SLLLRGARLKNTKEIFGVAVYTGMETKMALNYKSKSQKRSAVEKSMNTFLIIYLVILISE
AVISTILKYTWQAEEKWDEPWYNQKTEHQRNSSKILRFISDFLAFLVLYNFIIPISLYVT
VEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFR
ECSINGMKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETE
LIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYYASSPDEKALVEAAAR
IGIVFIGNSEETMEVKTLGKLERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESS
ILPKCIGGEIEKTRIHVDEFALKGLRTLCIAYRKFTSKEYEEIDKRIFEARTALQQREEK
LAAVFQFIEKDLILLGATAVEDRLQDKVRETIEALRMAGIKVWVLTGDKHETAVSVSLSC
GHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLF
MEVCRNCSAVLCCRMAPLQKAKVIRLIKISPEKPITLAVGDGANDVSMIQEAHVGIGIMG
KEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYC
LFSQQTLYDSVYLTLYNICFTSLPILIYSLLEQHVDPHVLQNKPTLYRDISKNRLLSIKT
FLYWTILGFSHAFIFFFGSYLLIGKDTSLLGNGQMFGNWTFGTLVFTVMVITVTVKMALE
THFWTWINHLVTWGSIIFYFVFSLFYGGILWPFLGSQNMYFVFIQLLSSGSAWFAIILMV
VTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERV
IGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PEJ6	0.849	0.840	0.000	1191	0.571	0.564	E9PEJ6.pdb.gz	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
2	AFDB:Q8NB49	0.867	0.900	0.000	1132	0.519	0.540	Q8NB49.pdb.gz	AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C PE=1 SV=3
3	AFDB:Q9Y2G3	1.000	1.000	0.000	1177	1.000	1.000	Q9Y2G3.pdb.gz	AT11B_HUMAN Phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2
4	PDB:7bspA	0.688	0.775	5.805E-92	1028	0.510	0.584	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
5	AFDB:Q9XIE6	0.829	0.805	3.692E-91	1213	0.351	0.340	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
6	AFDB:P70704	0.843	0.852	5.157E-91	1164	0.355	0.359	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
7	AFDB:Q9NTI2	0.844	0.837	6.354E-91	1188	0.357	0.354	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
8	AFDB:F4IE35	0.828	0.822	1.649E-89	1185	0.366	0.364	F4IE35.pdb.gz	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
9	AFDB:O94296	0.842	0.789	1.508E-88	1258	0.342	0.320	O94296.pdb.gz	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
10	AFDB:Q7YXV5	0.839	0.779	1.639E-88	1270	0.352	0.326	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
11	AFDB:Q9SAF5	0.844	0.826	2.289E-88	1203	0.347	0.339	Q9SAF5.pdb.gz	ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana OX=3702 GN=ALA11 PE=2 SV=1
12	PDB:6lknA	0.793	0.873	5.078E-84	1064	0.507	0.561	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
13	PDB:6rohA	0.824	0.871	3.651E-78	1112	0.347	0.367	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
14	PDB:7kycA	0.822	0.821	2.022E-77	1178	0.324	0.323	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7kyaA	0.825	0.827	5.440E-75	1174	0.315	0.316	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:7py4A	0.795	0.841	6.166E-75	1112	0.322	0.341	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
17	PDB:7vghB	0.803	0.799	3.986E-72	1183	0.325	0.323	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
18	PDB:7bssA	0.600	0.844	1.924E-69	816	0.420	0.605	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
19	PDB:6k7lA	0.774	0.914	7.629E-69	992	0.333	0.395	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
20	PDB:7rd6A	0.732	0.918	2.760E-60	929	0.246	0.312	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW70	652	1190	0.343	0.339	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
2	A0A8I5ZKC1	601	985	0.307	0.366	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
3	A0A8I5ZXX6	707	1164	0.363	0.367	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I6AVY6	710	1164	0.365	0.369	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6G2I8	602	978	0.307	0.369	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A3FIN4	641	1183	0.347	0.346	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
7	C7EXK4	680	1148	0.353	0.361	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
8	D4A3X6	691	1169	0.359	0.361	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
9	D4AA47	626	1251	0.333	0.313	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
10	E9PEJ6	1332	1191	0.559	0.552	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
11	F1LUT4	603	984	0.308	0.369	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
12	F4IE35	701	1185	0.367	0.365	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
13	F4K8T6	593	1139	0.318	0.328	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
14	H0Y547	1112	935	0.477	0.600	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
15	O43520	616	1251	0.334	0.314	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
16	O94296	682	1258	0.343	0.321	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
17	P39524	689	1355	0.358	0.311	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
18	P70704	707	1164	0.363	0.367	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
19	P98196	1333	1134	0.559	0.580	AT11A_HUMAN Phospholipid-transporting ATPase IH OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=3
20	P98197	1332	1187	0.561	0.556	AT11A_MOUSE Phospholipid-transporting ATPase IH OS=Mus musculus OX=10090 GN=Atp11a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.2e-08	46.2	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	3.9e-06	38.0	E1-E2 ATPase
3	PF00702 Hydrolase	4.6e-10	51.7	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	3.2	19.0	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	1.6e-75	265.7	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	2e-17	73.9	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321195

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.885	Cell cycle control protein 50A
2	9606.ENSP00000372005	0.806	Mitochondrial import inner membrane translocase subunit TIM14
3	9606.ENSP00000278282	0.764	Uteroglobin
4	9606.ENSP00000378046	0.713	Peptidyl-prolyl cis-trans isomerase FKBP2
5	9606.ENSP00000450842	0.704	Cell cycle control protein 50B
6	9606.ENSP00000419663	0.698	Cell cycle control protein 50C
7	9606.ENSP00000380516	0.688	Homeobox-containing protein 1
8	9606.ENSP00000350170	0.680	Fragile X mental retardation syndrome-related protein 1
9	9606.ENSP00000292782	0.589	DCN1-like protein 1
10	9606.ENSP00000328118	0.551	Probable guanine nucleotide exchange factor MCF2L2
11	9606.ENSP00000460964	0.533	ATP synthase mitochondrial F1 complex assembly factor 1
12	9606.ENSP00000335203	0.501	ATPase inhibitor, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140326	1.000	ATPase-coupled intramembrane lipid transporter activity
GO:0140327	0.975	flippase activity
GO:0005548	0.916	phospholipid transporter activity
GO:0140333	0.884	glycerophospholipid flippase activity
GO:0008525	0.325	phosphatidylcholine transporter activity
GO:0015247	0.314	aminophospholipid flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.910	biological regulation
GO:0051179	0.844	localization
GO:0051234	0.825	establishment of localization
GO:0006810	0.814	transport
GO:0006869	0.762	lipid transport
GO:0015914	0.744	phospholipid transport
GO:0050789	0.612	regulation of biological process
GO:0055085	0.510	transmembrane transport
GO:0050794	0.495	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.977	protein-containing complex
GO:0005886	0.952	plasma membrane
GO:1990351	0.948	transporter complex
GO:1990531	0.934	phospholipid-translocating ATPase complex
GO:0031090	0.925	organelle membrane
GO:0031982	0.898	vesicle
GO:0097708	0.795	intracellular vesicle
GO:0031410	0.788	cytoplasmic vesicle
GO:0098588	0.764	bounding membrane of organelle
GO:0005783	0.636	endoplasmic reticulum
GO:0030659	0.577	cytoplasmic vesicle membrane
GO:0099503	0.457	secretory vesicle
GO:0005768	0.381	endosome
GO:0030141	0.353	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]