StarFunc result for job id Q9Y2G4

User Input

>input (727 residues)
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGF
SQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHV
AARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSDPTPPADQQPG
HQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRL
QQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVD
QLVVTAGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPM
NEAARSDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRD
TSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLR
TRVQKEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2G4	1.000	1.000	8.143E-83	727	1.000	1.000	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
2	AFDB:Q69ZU8	0.420	0.428	1.262E-69	712	0.831	0.848	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
3	AFDB:F1RBU2	0.386	0.385	3.516E-50	729	0.520	0.519	F1RBU2.pdb.gz
4	AFDB:Q9NCP8	0.284	0.187	3.649E-17	1159	0.154	0.097	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
5	AFDB:Q80YE7	0.335	0.171	9.186E-17	1442	0.110	0.055	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
6	AFDB:Q0KIE7	0.334	0.158	1.269E-16	1549	0.153	0.072	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
7	AFDB:Q54KA7	0.327	0.243	1.836E-16	986	0.116	0.085	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
8	AFDB:Q8UVC1	0.324	0.233	2.108E-16	1021	0.164	0.117	Q8UVC1.pdb.gz	INVS_DANRE Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1
9	AFDB:Q8NFD2	0.332	0.316	2.656E-16	765	0.114	0.108	Q8NFD2.pdb.gz	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
10	AFDB:O15084	0.331	0.230	3.345E-16	1053	0.110	0.076	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
11	PDB:8cs9A	0.339	0.310	9.380E-16	796	0.117	0.107	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.331	0.165	1.512E-12	1499	0.111	0.054	5vkqA.pdb.gz
13	PDB:4oauC	0.313	0.328	3.471E-12	692	0.099	0.104	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.294	0.904	8.343E-12	229	0.089	0.284	2dvwA.pdb.gz
15	PDB:1wg0A	0.275	0.783	4.029E-10	243	0.076	0.226	1wg0A.pdb.gz
16	PDB:6v9hC	0.243	0.589	5.075E-10	270	0.094	0.252	6v9hC.pdb.gz
17	PDB:6aunA	0.298	0.348	7.010E-10	618	0.088	0.104	6aunA.pdb.gz
18	PDB:6mwqA	0.204	0.299	4.072E-8	493	0.081	0.120	6mwqA.pdb.gz
19	PDB:6pqpA	0.229	0.269	5.625E-8	615	0.080	0.094	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6v9xA	0.261	0.327	6.461E-8	571	0.089	0.114	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6NJE0	0.0	712	728	0.547	0.547	F6NJE0_DANRE Ankyrin repeat domain 6b OS=Danio rerio OX=7955 GN=ankrd6 PE=4 SV=1
2	Q69ZU8	0.0	1202	712	0.832	0.850	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
3	Q9Y2G4	0.0	1498	727	1.000	1.000	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
4	E5RJ05	4.73e-139	409	230	0.265	0.839	E5RJ05_HUMAN Ankyrin repeat domain 6 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD6 PE=1 SV=1
5	M9MRX4	2.98e-34	144	13559	0.127	0.007	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	A0A5F9ZHF7	9.41e-34	142	3862	0.124	0.023	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
7	A0A5F9ZI46	9.92e-34	142	3882	0.124	0.023	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZHT4	1.03e-33	142	3870	0.124	0.023	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZHT8	1.12e-33	142	3891	0.124	0.023	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A8JNM7	1.18e-33	142	4114	0.127	0.022	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	Q7KU92	1.22e-33	142	4083	0.127	0.023	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
12	A8JNM6	1.34e-33	141	4189	0.127	0.022	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9PEN3	1.35e-33	141	4373	0.127	0.021	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	M9MS19	1.36e-33	141	4230	0.127	0.022	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	X2JC49	1.40e-33	141	4233	0.127	0.022	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	M9MRS5	1.44e-33	141	4496	0.127	0.020	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MSK6	1.50e-33	141	4352	0.127	0.021	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	A8JNM5	1.56e-33	141	4264	0.127	0.022	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	M9MRX1	1.61e-33	141	4329	0.127	0.021	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9MRR4	1.64e-33	141	4223	0.127	0.022	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.6e-32	119.8	Ankyrin repeat
2	PF12796 Ank_2	1.2e-34	130.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.6e-22	88.0	Ankyrin repeat
4	PF13637 Ank_4	2.7e-33	125.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.6e-30	115.3	Ankyrin repeats (many copies)
6	PF15148 Apolipo_F	26	15.8	Apolipoprotein F
7	PF04286 DUF445	53	15.1	Protein of unknown function (DUF445)
8	PF10254 Pacs-1	3e+02	11.7	PACS-1 cytosolic sorting protein
9	PF05597 Phasin	73	14.8	Poly(hydroxyalcanoate) granule associated protein (phasin)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.975	Axin-1
2	9606.ENSP00000357040	0.945	Vang-like protein 2
3	9606.ENSP00000347672	0.924	VANGL planar cell polarity protein 1
4	9606.ENSP00000368169	0.814	Segment polarity protein dishevelled homolog DVL-1
5	9606.ENSP00000345064	0.813	Prickle-like protein 1
6	9606.ENSP00000295902	0.803	Prickle planar cell polarity protein 2
7	9606.ENSP00000470248	0.791	Prickle planar cell polarity protein 3
8	9606.ENSP00000262738	0.766	Cadherin EGF LAG seven-pass G-type receptor 1
9	9606.ENSP00000005340	0.755	Segment polarity protein dishevelled homolog DVL-2
10	9606.ENSP00000316054	0.727	Segment polarity protein dishevelled homolog DVL-3
11	9606.ENSP00000369695	0.724	Protein AF-9
12	9606.ENSP00000380044	0.708	Casein kinase I isoform epsilon
13	9606.ENSP00000164024	0.678	Cadherin EGF LAG seven-pass G-type receptor 3
14	9606.ENSP00000324127	0.672	PH and SEC7 domain-containing protein 3
15	9606.ENSP00000271332	0.670	Cadherin EGF LAG seven-pass G-type receptor 2
16	9606.ENSP00000346378	0.670	Amyloid-beta A4 precursor protein-binding family B member 3
17	9606.ENSP00000353769	0.646	Splicing factor, arginine/serine-rich 19
18	9606.ENSP00000238561	0.641	Uncharacterized aarF domain-containing protein kinase 1
19	9606.ENSP00000072869	0.631	Uncharacterized aarF domain-containing protein kinase 2
20	9606.ENSP00000302625	0.620	Axin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0048522	0.991	positive regulation of cellular process
GO:0023051	0.990	regulation of signaling
GO:0010646	0.990	regulation of cell communication
GO:0048583	0.987	regulation of response to stimulus
GO:0048523	0.971	negative regulation of cellular process
GO:0009966	0.966	regulation of signal transduction
GO:0048585	0.954	negative regulation of response to stimulus
GO:0030111	0.952	regulation of Wnt signaling pathway
GO:0009987	0.925	cellular process
GO:0030178	0.917	negative regulation of Wnt signaling pathway
GO:0009967	0.898	positive regulation of signal transduction
GO:0060828	0.860	regulation of canonical Wnt signaling pathway
GO:0050793	0.770	regulation of developmental process
GO:0090090	0.760	negative regulation of canonical Wnt signaling pathway
GO:0022603	0.564	regulation of anatomical structure morphogenesis
GO:0032501	0.544	multicellular organismal process
GO:0032502	0.528	developmental process
GO:0048856	0.518	anatomical structure development
GO:0030177	0.508	positive regulation of Wnt signaling pathway
GO:0019222	0.440	regulation of metabolic process
GO:0007275	0.395	multicellular organism development
GO:0060255	0.315	regulation of macromolecule metabolic process
GO:0031323	0.313	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.896	cytoplasm
GO:0005634	0.773	nucleus
GO:0016020	0.478	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]