StarFunc result for job id Q9Y2G9

User Input

>input (1366 residues)
MLAVGPAMDRDYPQHEPPPAGSLLYSPPPLQSAMLHCPYWNTFSLPPYPAFSSDSRPFMS
SASFLGSQPCPDTSYAPVATASSLPPKTCDFAQDSSYFEDFSNISIFSSSVDSLSDIVDT
PDFLPADSLNQVSTIWDDNPAPSTHDKLFQLSRPFAGFEDFLPSHSTPLLVSYQEQSVQS
QPEEEDEAEEEEAEELGHTETYADYVPSKSKIGKQHPDRVVETSTLSSVPPPDITYTLAL
PSDSGALSALQLEAITYACQQHEVLLPSGQRAGFLIGDGAGVGKGRTVAGVILENHLRGR
KKALWFSVSNDLKYDAERDLRDIEATGIAVHALSKIKYGDTTTSEGVLFATYSALIGESQ
AGGQHRTRLRQILDWCGEAFEGVIVFDECHKAKNAGSTKMGKAVLDLQNKLPLARVVYAS
ATGASEPRNMIYMSRLGIWGEGTPFRNFEEFLHAIEKRGVGAMEIVAMDMKVSGMYIARQ
LSFSGVTFRIEEIPLAPAFECVYNRAALLWAEALNVFQQAADWIGLESRKSLWGQFWSAH
QRFFKYLCIAAKVRRLVELAREELARDKCVVIGLQSTGEARTREVLGENDGHLNCFVSAA
EGVFLSLIQKHFPSTKRKRDRGAGSKRKRRPRGRGAKAPRLACETAGVIRISDDSSTESD
PGLDSDFNSSPESLVDDDVVIVDAVGLPSDDRGPLCLLQRDPHGPGVLERVERLKQDLLD
KVRRLGRELPVNTLDELIDQLGGPQRVAEMTGRKGRVVSRPDGTVAFESRAEQGLSIDHV
NLREKQRFMSGEKLVAIISEASSSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGR
THRSNQVSAPEYVFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENK
YGTRALHCVLTTILSQTENKVPVPQGYPGGVPTFFRDMKQGLLSVGIGGRESRNGCLDVE
KDCSITKFLNRILGLEVHKQNALFQYFSDTFDHLIEMDKREGKYDMGILDLAPGIEEIYE
ESQQVFLAPGHPQDGQVVFYKISVDRGLKWEDAFAKSLALTGPYDGFYLSYKVRGNKPSC
LLAEQNRGQFFTVYKPNIGRQSQLEALDSLRRKFHRVTAEEAKEPWESGYALSLTHCSHS
AWNRHCRLAQEGKDCLQGLRLRHHYMLCGALLRVWGRIAAVMADVSSSSYLQIVRLKTKD
RKKQVGIKIPEGCVRRVLQELRLMDADVKRRQAPALGCPAPPAPRPLALPCGPGEVLDLT
YSPPAEAFPPPPHFSFPAPLSLDAGPGVVPLGTPDAQADPAALAHQGCDINFKEVLEDML
RSLHAGPPSEGALGEGAGAGGAAGGGPERQSVIQFSPPFPGAQAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2L9F7	0.676	0.667	0.000	1385	0.470	0.464	A0A0G2L9F7.pdb.gz
2	AFDB:Q9Y2G9	1.000	1.000	0.000	1366	1.000	1.000	Q9Y2G9.pdb.gz	SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo sapiens OX=9606 GN=SBNO2 PE=2 SV=3
3	PDB:7m8eF	0.202	0.268	2.126E-9	967	0.082	0.116	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
4	PDB:6g0lM	0.228	0.350	4.740E-8	855	0.070	0.112	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:5dcaA	0.189	0.138	5.536E-8	1948	0.080	0.056	5dcaA.pdb.gz
6	PDB:7oo3b	0.241	0.554	7.171E-8	534	0.054	0.139	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
7	PDB:7epuB	0.185	0.293	1.085E-7	748	0.070	0.127	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
8	PDB:2xgjB	0.202	0.331	1.203E-7	777	0.070	0.122	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
9	PDB:6ro1A	0.210	0.301	1.480E-7	919	0.078	0.115	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
10	PDB:5vvrM	0.227	0.545	1.728E-7	503	0.048	0.131	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
11	PDB:6g0lW	0.240	0.358	4.619E-7	878	0.067	0.105	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:7zsa7	0.204	0.416	5.983E-7	616	0.056	0.123	7zsa7.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
13	AFDB:Q64060	0.194	0.343	9.517E-7	713	0.081	0.154	Q64060.pdb.gz	DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus OX=10116 GN=Ddx4 PE=1 SV=1
14	AFDB:Q38DF6	0.198	0.344	1.597E-6	735	0.068	0.127	Q38DF6.pdb.gz	Q38DF6_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3510 PE=3 SV=1
15	AFDB:Q9JIK5	0.194	0.298	3.750E-5	851	0.080	0.128	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
16	AFDB:P90897	0.210	0.287	5.115E-5	959	0.070	0.099	P90897.pdb.gz	RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans OX=6239 GN=rde-12 PE=1 SV=4
17	AFDB:Q9VGI8	0.212	0.198	2.821E-4	1487	0.105	0.096	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
18	AFDB:Q22308	0.172	0.224	7.540E-4	1022	0.075	0.101	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2
19	AFDB:F4IDQ6	0.163	0.143	8.581E-3	1576	0.094	0.082	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
20	AFDB:O64728	0.067	0.073	3.470E-2	1218	0.083	0.093	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8JUV0	0.0	584	1653	0.211	0.174	SBNO_DROME Protein strawberry notch OS=Drosophila melanogaster OX=7227 GN=sno PE=1 SV=2
2	D6RUV3	0.0	612	1386	0.217	0.214	D6RUV3_DANRE Protein strawberry notch homolog 1 OS=Danio rerio OX=7955 GN=sbno1 PE=1 SV=1
3	D6RUV4	0.0	1483	1350	0.585	0.592	D6RUV4_DANRE Strawberry notch homolog 2a OS=Danio rerio OX=7955 GN=sb:eu274 PE=1 SV=1
4	F4IF36	0.0	758	1295	0.332	0.351	FGT1_ARATH Protein FORGETTER 1 OS=Arabidopsis thaliana OX=3702 GN=FGT1 PE=1 SV=1
5	Q7TNB8	0.0	2117	1349	0.816	0.826	SBNO2_MOUSE Protein strawberry notch homolog 2 OS=Mus musculus OX=10090 GN=Sbno2 PE=1 SV=1
6	Q9Y2G9	0.0	2811	1366	1.000	1.000	SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo sapiens OX=9606 GN=SBNO2 PE=2 SV=3
7	O01737	5.55e-153	509	1866	0.184	0.135	SBNO_CAEEL Protein strawberry notch homolog OS=Caenorhabditis elegans OX=6239 GN=let-765 PE=1 SV=3
8	P70496	0.061	40.4	1074	0.037	0.047	PLD1_RAT Phospholipase D1 OS=Rattus norvegicus OX=10116 GN=Pld1 PE=1 SV=3
9	Q9Z280	0.43	37.4	1074	0.037	0.047	PLD1_MOUSE Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1
10	Q13393	0.83	36.6	1074	0.036	0.046	PLD1_HUMAN Phospholipase D1 OS=Homo sapiens OX=9606 GN=PLD1 PE=1 SV=1
11	Q99JG7	0.86	36.2	430	0.020	0.065	TNIP2_MOUSE TNFAIP3-interacting protein 2 OS=Mus musculus OX=10090 GN=Tnip2 PE=1 SV=1
12	Q59EA4	0.87	36.6	1059	0.036	0.046	Q59EA4_HUMAN phospholipase D (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q12481	1.0	35.8	300	0.018	0.083	RRP36_YEAST rRNA biogenesis protein RRP36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP36 PE=1 SV=1
14	P84480	2.1	34.7	290	0.015	0.069	MREC_GEOSE Cell shape-determining protein MreC OS=Geobacillus stearothermophilus OX=1422 GN=mreC PE=3 SV=1
15	Q01466	2.1	34.7	290	0.015	0.069	MREC_BACSU Cell shape-determining protein MreC OS=Bacillus subtilis (strain 168) OX=224308 GN=mreC PE=1 SV=3
16	Q9Y7Z8	4.0	34.3	1217	0.017	0.019	MYO1_SCHPO Myosin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo1 PE=1 SV=1
17	P07260	4.6	33.1	213	0.022	0.141	IF4E_YEAST Eukaryotic translation initiation factor 4E OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC33 PE=1 SV=1
18	A2A8L1	6.4	33.9	1946	0.048	0.033	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1
19	Q586B8	7.1	33.5	870	0.020	0.031	Q586B8_TRYB2 ATP-dependent Clp protease subunit, heat shock protein 100 (HSP100), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.360 PE=3 SV=1
20	Q3UVX5	7.9	33.5	1203	0.015	0.017	GRM5_MOUSE Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13872 AAA_34	1.2e-123	423.5	P-loop containing NTP hydrolase pore-1
2	PF13871 Helicase_C_4	2.2e-112	386.8	C-terminal domain on Strawberry notch homologue
3	PF04851 ResIII	0.016	26.7	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331305	0.667	Protein Tob2
2	9606.ENSP00000361107	0.651	Bone morphogenetic protein receptor type-1A
3	9606.ENSP00000341170	0.647	Pleiotrophin
4	9606.ENSP00000338157	0.645	Zinc finger and BTB domain-containing protein 16
5	9606.ENSP00000340874	0.644	Myocyte-specific enhancer factor 2C
6	9606.ENSP00000398736	0.643	Protein CYR61
7	9606.ENSP00000284523	0.642	Protein Wnt-3a
8	9606.ENSP00000357175	0.632	ETS translocation variant 3
9	9606.ENSP00000164227	0.627	B-cell lymphoma 3 protein
10	9606.ENSP00000360493	0.619	Runt-related transcription factor 2
11	9606.ENSP00000414517	0.606	Mastermind-like domain-containing protein 1
12	9606.ENSP00000376097	0.584	Unconventional prefoldin RPB5 interactor 1
13	9606.ENSP00000279028	0.574	Osteoclast stimulatory transmembrane protein
14	9606.ENSP00000300952	0.565	Midnolin
15	9606.ENSP00000465260	0.564	Voltage-dependent calcium channel beta subunit-associated regulatory protein
16	9606.ENSP00000304364	0.557	C1GALT1-specific chaperone 1
17	9606.ENSP00000389176	0.555	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
18	9606.ENSP00000358045	0.548	Extracellular matrix protein 1
19	9606.ENSP00000386557	0.547	Uncharacterized membrane protein C19orf24
20	9606.ENSP00000356954	0.546	Connective tissue growth factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.787	heterocyclic compound binding
GO:0097159	0.787	organic cyclic compound binding
GO:0003676	0.580	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050896	0.990	response to stimulus
GO:0050794	0.980	regulation of cellular process
GO:0032501	0.971	multicellular organismal process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0080090	0.906	regulation of primary metabolic process
GO:0051716	0.896	cellular response to stimulus
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0048519	0.883	negative regulation of biological process
GO:0048583	0.878	regulation of response to stimulus
GO:0031323	0.869	regulation of cellular metabolic process
GO:0010468	0.868	regulation of gene expression
GO:0048523	0.866	negative regulation of cellular process
GO:0019219	0.864	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.846	regulation of RNA metabolic process
GO:0006355	0.842	regulation of DNA-templated transcription
GO:0051172	0.743	negative regulation of nitrogen compound metabolic process
GO:0031324	0.727	negative regulation of cellular metabolic process
GO:0010605	0.721	negative regulation of macromolecule metabolic process
GO:0042221	0.702	response to chemical
GO:0048856	0.659	anatomical structure development
GO:0051253	0.657	negative regulation of RNA metabolic process
GO:0031327	0.649	negative regulation of cellular biosynthetic process
GO:0010033	0.636	response to organic substance
GO:0034097	0.552	response to cytokine
GO:1902679	0.546	negative regulation of RNA biosynthetic process
GO:0070887	0.464	cellular response to chemical stimulus
GO:0048518	0.395	positive regulation of biological process
GO:0045892	0.383	negative regulation of DNA-templated transcription
GO:0048522	0.361	positive regulation of cellular process
GO:0071310	0.323	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.870	cytoplasm
GO:0070013	0.670	intracellular organelle lumen
GO:0005829	0.333	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]