StarFunc result for job id Q9Y2H0

User Input

>input (992 residues)
MKGLGDSRPRHLSDSLDPPHEPLFAGTDRNPYLLSPTEAFAREARFPGQNTLPGDGLFPL
NNQLPPPSSTFPRIHYNSHFEVPEESPFPSHAQATKINRLPANLLDQFEKQLPIHRDGFS
TLQFPRGEAKARGESPGRIRHLVHSVQRLFFTKAPSLEGTAGKVGGNGSKKGGMEDGKGR
RAKSKERAKAGEPKRRSRSNISGWWSSDDNLDGEAGAFRSSGPASGLMTLGRQAERSQPR
YFMHAYNTISGHMLKTTKNNTTELTAPPPPPAPPATCPSLGVGTDTNYVKRGSWSTLTLS
HAHEVCQKTSATLDKSLLKSKSCHQGLAYHYLQVPGGGGEWSTTLLSPRETDAAAEGPIP
CRRMRSGSYIKAMGDEDSDESGGSPKPSPKTAARRQSYLRATQQSLGEQSNPRRSLDRLD
SVDMLLPSKCPSWEEDYTPVSDSLNDSSCISQIFGQASLIPQLFGHEQQVREAELSDQYE
AACESACSEAESTAAETLDLPLPSYFRSRSHSYLRAIQAGCSQEEDSVSLQSLSPPPSTG
SLSNSRTLPSSSCLVAYKKTPPPVPPRTTSKPFISVTVQSSTESAQDTYLDSQDHKSEVT
SQSGLSNSSDSLDSSTRPPSVTRGGVAPAPEAPEPPPKHAALKSEQGTLTSSESHPEAAP
KRKLSSIGIQVDCIQPVPKEEPSPATKFQSIGVQVEDDWRSSVPSHSMSSRRDTDSDTQD
ANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPALEASSLPPP
DPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLG
KVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFD
ELYHLKANSWQLVETPEKRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRL
LAAKRAASVRQNSATESADSIEIYVPEAQTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AZP2	0.417	0.417	0.000	992	0.969	0.969	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
2	AFDB:P97836	0.229	0.229	2.588E-50	992	0.466	0.466	P97836.pdb.gz	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
3	AFDB:Q9P1A6	0.185	0.177	1.291E-44	1054	0.425	0.400	Q9P1A6.pdb.gz	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
4	AFDB:P97837	0.182	0.173	3.083E-44	1059	0.426	0.399	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
5	PDB:4r0yB	0.109	0.227	8.413E-12	473	0.082	0.171	4r0yB.pdb.gz
6	AFDB:Q3V089	0.063	0.062	2.708E-3	1013	0.118	0.115	Q3V089.pdb.gz	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
7	AFDB:Q9V3H9	0.040	0.039	5.129E-3	1004	0.115	0.114	Q9V3H9.pdb.gz	Q9V3H9_DROME Zinc finger CCCH domain-containing protein 14 OS=Drosophila melanogaster OX=7227 GN=Nab2 PE=1 SV=1
8	AFDB:P50111	0.045	0.048	6.856E-3	915	0.134	0.145	P50111.pdb.gz	ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZDS1 PE=1 SV=1
9	AFDB:F4IZK5	0.068	0.052	1.736E-2	1403	0.165	0.117	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
10	AFDB:A0A0R4IS11	0.041	0.031	1.949E-2	1565	0.165	0.105	A0A0R4IS11.pdb.gz
11	AFDB:Q7KHG2	0.042	0.034	2.189E-2	1486	0.154	0.103	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
12	PDB:1wn0C	0.058	0.352	6.552E-1	138	0.011	0.080	1wn0C.pdb.gz
13	PDB:5mx5L	0.092	0.333	8.759E-1	214	0.018	0.084	5mx5L.pdb.gz
14	PDB:6ybwz	0.044	0.141	9.837E-1	160	0.023	0.144	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.
15	PDB:7naod	0.094	0.334	9.837E-1	217	0.027	0.124	7naod.pdb.gz
16	PDB:1yviA	0.059	0.355	1.171	140	0.009	0.064	1yviA.pdb.gz
17	PDB:7z37DP1	0.051	0.158	1.315	273	0.019	0.070	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
18	PDB:1rj1A	0.074	0.426	1.477	148	0.011	0.074	1rj1A.pdb.gz
19	PDB:5n9jV	0.062	0.460	1.565	99	0.015	0.152	5n9jV.pdb.gz
20	PDB:7be8A	0.054	0.166	1.659	219	0.013	0.059	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AZP2	0.0	1968	992	0.970	0.970	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
2	O14490	0.0	743	977	0.489	0.496	DLGP1_HUMAN Disks large-associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
3	P97836	0.0	729	992	0.488	0.488	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
4	P97837	0.0	601	1059	0.454	0.425	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
5	P97839	0.0	1717	992	0.963	0.963	DLGP4_RAT Disks large-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Dlgap4 PE=1 SV=1
6	Q8BJ42	0.0	600	1059	0.445	0.416	DLGP2_MOUSE Disks large-associated protein 2 OS=Mus musculus OX=10090 GN=Dlgap2 PE=1 SV=2
7	Q9D415	0.0	723	992	0.487	0.487	DLGP1_MOUSE Disks large-associated protein 1 OS=Mus musculus OX=10090 GN=Dlgap1 PE=1 SV=3
8	Q9P1A6	0.0	608	1054	0.463	0.435	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
9	Q9Y2H0	0.0	2025	992	1.000	1.000	DLGP4_HUMAN Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3
10	O95886	8.33e-141	448	979	0.387	0.392	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
11	Q6PFD5	7.98e-140	445	977	0.393	0.399	DLGP3_MOUSE Disks large-associated protein 3 OS=Mus musculus OX=10090 GN=Dlgap3 PE=1 SV=1
12	P97838	7.72e-136	434	977	0.394	0.400	DLGP3_RAT Disks large-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Dlgap3 PE=1 SV=2
13	Q6IS01	2.29e-126	396	543	0.254	0.464	Q6IS01_HUMAN DLG associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
14	Q15398	2.63e-16	86.3	846	0.058	0.069	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
15	Q7K3L1	3.31e-10	66.6	921	0.039	0.042	MARS_DROME Guanylate kinase-associated protein mars OS=Drosophila melanogaster OX=7227 GN=mars PE=1 SV=1
16	Q0WPQ2	4.9	33.5	773	0.022	0.028	ETR2_ARATH Ethylene receptor 2 OS=Arabidopsis thaliana OX=3702 GN=ETR2 PE=1 SV=2
17	Q57VA9	6.4	33.1	735	0.019	0.026	Q57VA9_TRYB2 Calpain-like cysteine peptidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.710 PE=4 SV=1
18	Q90XA8	8.6	32.7	489	0.025	0.051	Q90XA8_DANRE Heat shock factor Hsf2 OS=Danio rerio OX=7955 GN=zfHSF2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03359 GKAP	1e-147	503.8	Guanylate-kinase-associated protein (GKAP) protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000021606

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000013811	0.809	Discs, large homolog 4 (Drosophila)
2	9544.ENSMMUP00000007389	0.799	Uncharacterized protein
3	9544.ENSMMUP00000027132	0.752	Uncharacterized protein
4	9544.ENSMMUP00000012255	0.745	SH3 and multiple ankyrin repeat domains 1
5	9544.ENSMMUP00000030340	0.668	Glutamate metabotropic receptor 4
6	9544.ENSMMUP00000008185	0.661	Calsyntenin-1 isoform 1
7	9544.ENSMMUP00000013967	0.651	Synaptic Ras GTPase activating protein 1
8	9544.ENSMMUP00000018335	0.634	Discs large MAGUK scaffold protein 3
9	9544.ENSMMUP00000036808	0.630	Discs large MAGUK scaffold protein 2
10	9544.ENSMMUP00000030625	0.622	Kinesin-like protein KIF11
11	9544.ENSMMUP00000021791	0.591	Disks large homolog 1 isoform 2
12	9544.ENSMMUP00000003239	0.561	Drebrin-like
13	9544.ENSMMUP00000019114	0.560	Syntaxin-1A isoform 1
14	9544.ENSMMUP00000006208	0.556	Neuroligin-1
15	9544.ENSMMUP00000013387	0.540	Zinc finger protein 316
16	9544.ENSMMUP00000035873	0.540	Discs large MAGUK scaffold protein 5
17	9544.ENSMMUP00000024940	0.529	NDC80, kinetochore complex component
18	9544.ENSMMUP00000020495	0.513	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.352	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.925	regulation of cellular process
GO:0023052	0.563	signaling
GO:0007154	0.505	cell communication
GO:0071704	0.423	organic substance metabolic process
GO:0044238	0.367	primary metabolic process
GO:1901564	0.350	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.995	organelle
GO:0005622	0.979	intracellular anatomical structure
GO:0005737	0.965	cytoplasm
GO:0098978	0.957	glutamatergic synapse
GO:0098794	0.957	postsynapse
GO:0099572	0.954	postsynaptic specialization
GO:0030425	0.925	dendrite
GO:0043229	0.772	intracellular organelle
GO:0032279	0.696	asymmetric synapse
GO:0043228	0.683	non-membrane-bounded organelle
GO:0014069	0.651	postsynaptic density
GO:0031594	0.541	neuromuscular junction
GO:0043227	0.482	membrane-bounded organelle
GO:0043232	0.397	intracellular non-membrane-bounded organelle
GO:0043231	0.397	intracellular membrane-bounded organelle
GO:0012505	0.390	endomembrane system
GO:0098981	0.340	cholinergic synapse
GO:0005829	0.318	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]