StarFunc result for job id Q9Y2H2

User Input

>input (1132 residues)
MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSD
LPWWLILIRQKALVGKLPGDHEVCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKI
IPSPDDSKFLLKTFTHIKSNVSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSL
TYDLTNSVQRQSTGERDGRPLWQKVDDRFFWNKYMIQDLTEIGTPDVDFWIIPMIQGFVQ
IEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVALISRRSRHRAGMRYKRRGVDK
NGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVGYRYNPRPRLDRSEKETVAYFCA
HFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKQVLLFNNSHLTYVSFDFHEHCRGMKFE
NVQTLTDAIYDIILDMKWCWVDEAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQ
LKKLGVMPPEQPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKD
GVNSANRYYLNRFKDAYRQAVIDLMQGIPVTEDLYSIFTKEKEHEALHKENQRSHQELIS
QLLQSYMKLLLPDDEKFHGGWALIDCDPSLIDATHRDVDVLLLLSNSAYYVAYYDDEVDK
VNQYQRLSLENLEKIEIGPEPTLFGKPKFSCMRLHYRYKEASGYFHTLRAVMRNPEEDGK
DTLQCIAEMLQITKQAMGSDLPIIEKKLERKSSKPHEDIIGIRSQNQGSLAQGKNFLMSK
FSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVM
DKVQAESDGDMSSDNDSYHSDEFLTNSKSDEDRQLANSLESVGPIDYVLPSCGIIASAPR
LGSRSQSLSSTDSSVHAPSEITVAHGSGLGKGQESPLKKSPSAGDVHILTGFAKPMDIYC
HRFVQDAQNKVTHLSETRSVSQQASQERNQMTNQVSNETQSESTEQTPSRPSQLDVSLSA
TGPQFLSVEPAHSVASQKTPTSASSMLELETGLHVTPSPSESSSSRAVSPFAKIRSSMVQ
VASITQAGLTHGINFAVSKVQKSPPEPEIINQVQQNELKKMFIQCQTRIIQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CDA1	0.625	0.625	0.000	1132	0.905	0.905	Q8CDA1.pdb.gz	SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus OX=10090 GN=Inpp5f PE=1 SV=1
2	AFDB:Q9W0I6	0.402	0.753	2.726E-46	592	0.164	0.314	Q9W0I6.pdb.gz	SAC1_DROME Phosphatidylinositol-3-phosphatase SAC1 OS=Drosophila melanogaster OX=7227 GN=Sac1 PE=2 SV=1
3	AFDB:Q62910	0.384	0.278	3.978E-31	1574	0.212	0.152	Q62910.pdb.gz	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
4	PDB:4tu3X	0.294	0.796	4.164E-28	400	0.108	0.305	4tu3X.pdb.gz
5	PDB:7k1wF	0.319	0.735	1.304E-24	462	0.100	0.245	7k1wF.pdb.gz
6	AFDB:A0A0M3U1B0	0.072	0.088	9.824E-5	842	0.085	0.114	A0A0M3U1B0.pdb.gz	SYC2L_MOUSE Synaptonemal complex protein 2-like OS=Mus musculus OX=10090 GN=Sycp2l PE=2 SV=1
7	AFDB:D1MYR8	0.091	0.100	1.036E-4	1007	0.092	0.103	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
8	PDB:3uzsA	0.085	0.141	1.608E-3	609	0.033	0.061	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
9	PDB:4mk0A	0.087	0.144	1.789E-3	631	0.025	0.044	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	PDB:5yqrA	0.075	0.271	2.598E-3	268	0.026	0.108	5yqrA.pdb.gz
11	AFDB:O60292	0.075	0.049	4.326E-3	1781	0.111	0.071	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
12	PDB:1lw3A	0.084	0.171	1.096E-2	513	0.019	0.041	1lw3A.pdb.gz
13	PDB:4gouA	0.079	0.151	1.592E-2	507	0.043	0.097	4gouA.pdb.gz
14	PDB:7mp5A	0.074	0.053	1.771E-2	1629	0.046	0.032	7mp5A.pdb.gz
15	AFDB:Q8C0T5	0.078	0.053	2.141E-2	1782	0.108	0.068	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
16	PDB:6xtbE	0.076	0.309	2.192E-2	235	0.014	0.068	6xtbE.pdb.gz
17	AFDB:Q8IYT1	0.075	0.130	2.512E-2	594	0.062	0.118	Q8IYT1.pdb.gz	GAR4_HUMAN Golgi-associated RAB2 interactor protein 4 OS=Homo sapiens OX=9606 GN=GARIN4 PE=1 SV=2
18	AFDB:O43166	0.076	0.049	3.109E-2	1804	0.112	0.070	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
19	PDB:5bx1A	0.099	0.484	3.357E-2	153	0.021	0.157	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
20	AFDB:F1MAL5	0.076	0.066	3.459E-2	1327	0.060	0.051	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IRJ9	0.0	2202	1070	0.945	1.000	A0A3B3IRJ9_HUMAN Inositol polyphosphate-5-phosphatase F OS=Homo sapiens OX=9606 GN=INPP5F PE=1 SV=1
2	A0A3B3ITL0	0.0	2164	1036	0.915	1.000	A0A3B3ITL0_HUMAN Inositol polyphosphate-5-phosphatase F OS=Homo sapiens OX=9606 GN=INPP5F PE=1 SV=1
3	D3ZKG7	0.0	2067	1130	0.903	0.904	D3ZKG7_RAT Inositol polyphosphate-5-phosphatase F OS=Rattus norvegicus OX=10116 GN=Inpp5f PE=1 SV=1
4	Q8CDA1	0.0	2070	1132	0.905	0.905	SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus OX=10090 GN=Inpp5f PE=1 SV=1
5	Q9Y2H2	0.0	2364	1132	1.000	1.000	SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens OX=9606 GN=INPP5F PE=1 SV=3
6	Q0KI33	1.16e-159	506	1142	0.227	0.225	Q0KI33_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=sp3 PE=1 SV=2
7	Q9ES21	3.06e-91	306	587	0.144	0.278	SAC1_RAT Phosphatidylinositol-3-phosphatase SAC1 OS=Rattus norvegicus OX=10116 GN=Sacm1l PE=1 SV=1
8	Q9NTJ5	1.80e-90	305	587	0.143	0.276	SAC1_HUMAN Phosphatidylinositol-3-phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L PE=1 SV=2
9	Q9EP69	7.25e-89	300	587	0.140	0.271	SAC1_MOUSE Phosphatidylinositol-3-phosphatase SAC1 OS=Mus musculus OX=10090 GN=Sacm1l PE=1 SV=1
10	Q55AW9	3.47e-83	284	581	0.149	0.291	SAC1_DICDI Phosphatidylinositol-3-phosphatase SAC1 OS=Dictyostelium discoideum OX=44689 GN=sac1 PE=3 SV=1
11	O60162	1.22e-80	278	598	0.148	0.281	YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19F5.03 PE=1 SV=1
12	Q9W0I6	3.40e-79	273	592	0.147	0.280	SAC1_DROME Phosphatidylinositol-3-phosphatase SAC1 OS=Drosophila melanogaster OX=7227 GN=Sac1 PE=2 SV=1
13	P32368	4.52e-79	274	623	0.140	0.255	SAC1_YEAST Phosphatidylinositol-3-phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAC1 PE=1 SV=1
14	A0A1D8PEV5	1.10e-73	259	618	0.140	0.257	A0A1D8PEV5_CANAL Phosphatidylinositol-3-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAC1 PE=4 SV=1
15	Q9C5G5	1.78e-71	252	597	0.138	0.261	SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana OX=3702 GN=SAC7 PE=2 SV=1
16	Q7X911	2.78e-70	248	593	0.133	0.253	SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana OX=3702 GN=SAC6 PE=2 SV=1
17	Q96328	3.14e-70	248	588	0.125	0.240	SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana OX=3702 GN=SAC8 PE=2 SV=1
18	Q54D97	1.02e-61	233	1379	0.128	0.105	Q54D97_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P3 PE=4 SV=1
19	O14127	1.05e-56	209	611	0.130	0.241	YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3C7.01c PE=4 SV=2
20	O43426	3.35e-53	206	1573	0.123	0.088	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10374 EST1	9.8e+02	11.6	Telomerase activating protein Est1
2	PF12456 hSac2	3.1e-18	76.8	Inositol phosphatase
3	PF02383 Syja_N	8.9e-89	309.6	SacI homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357883	0.940	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
2	9606.ENSP00000466363	0.933	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
3	9606.ENSP00000264380	0.929	1-phosphatidylinositol 3-phosphate 5-kinase
4	9606.ENSP00000265382	0.927	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
5	9606.ENSP00000373399	0.927	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
6	9606.ENSP00000356155	0.926	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
7	9606.ENSP00000262039	0.923	Phosphatidylinositol 3-kinase catalytic subunit type 3
8	9606.ENSP00000265970	0.923	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
9	9606.ENSP00000376142	0.921	Inositol polyphosphate-1-phosphatase
10	9606.ENSP00000445381	0.918	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
11	9606.ENSP00000219789	0.914	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
12	9606.ENSP00000373713	0.914	Phosphatidylinositide phosphatase SAC1
13	9606.ENSP00000074304	0.911	Type I inositol 3,4-bisphosphate 4-phosphatase
14	9606.ENSP00000361021	0.910	Phosphatase and tensin homolog
15	9606.ENSP00000383089	0.910	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
16	9606.ENSP00000425487	0.908	Type II inositol 3,4-bisphosphate 4-phosphatase
17	9606.ENSP00000428056	0.908	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000222254	0.903	Phosphatidylinositol 3-kinase regulatory subunit beta
19	9606.ENSP00000262741	0.903	Phosphatidylinositol 3-kinase regulatory subunit gamma
20	9606.ENSP00000361064	0.902	Multiple inositol polyphosphate phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0034596	1.000	phosphatidylinositol phosphate 4-phosphatase activity
GO:0052745	0.956	inositol phosphate phosphatase activity
GO:0034595	0.772	phosphatidylinositol phosphate 5-phosphatase activity
GO:0052833	0.617	inositol monophosphate 4-phosphatase activity
GO:0034593	0.402	phosphatidylinositol bisphosphate phosphatase activity
GO:0052744	0.338	phosphatidylinositol monophosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0051174	0.988	regulation of phosphorus metabolic process
GO:0023051	0.973	regulation of signaling
GO:0046488	0.971	phosphatidylinositol metabolic process
GO:0019220	0.970	regulation of phosphate metabolic process
GO:0048519	0.963	negative regulation of biological process
GO:0048523	0.950	negative regulation of cellular process
GO:0031399	0.946	regulation of protein modification process
GO:0009966	0.945	regulation of signal transduction
GO:0042325	0.944	regulation of phosphorylation
GO:0008610	0.938	lipid biosynthetic process
GO:0048585	0.929	negative regulation of response to stimulus
GO:0001932	0.909	regulation of protein phosphorylation
GO:0090407	0.905	organophosphate biosynthetic process
GO:0016311	0.902	dephosphorylation
GO:0010563	0.899	negative regulation of phosphorus metabolic process
GO:0008654	0.897	phospholipid biosynthetic process
GO:0023057	0.891	negative regulation of signaling
GO:0030258	0.889	lipid modification
GO:0045017	0.887	glycerolipid biosynthetic process
GO:0031400	0.883	negative regulation of protein modification process
GO:0009968	0.878	negative regulation of signal transduction
GO:0046474	0.871	glycerophospholipid biosynthetic process
GO:0046856	0.869	phosphatidylinositol dephosphorylation
GO:0042326	0.866	negative regulation of phosphorylation
GO:0001933	0.837	negative regulation of protein phosphorylation
GO:0048522	0.816	positive regulation of cellular process
GO:0006661	0.799	phosphatidylinositol biosynthetic process
GO:2000145	0.661	regulation of cell motility
GO:0050896	0.651	response to stimulus
GO:0007154	0.620	cell communication
GO:0023052	0.613	signaling
GO:0051716	0.612	cellular response to stimulus
GO:0060341	0.607	regulation of cellular localization
GO:1902531	0.592	regulation of intracellular signal transduction
GO:0007165	0.522	signal transduction
GO:0060627	0.464	regulation of vesicle-mediated transport
GO:1904892	0.431	regulation of receptor signaling pathway via STAT
GO:0009893	0.338	positive regulation of metabolic process
GO:0031325	0.318	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005737	0.990	cytoplasm
GO:0031982	0.961	vesicle
GO:0016020	0.958	membrane
GO:0005829	0.921	cytosol
GO:0031410	0.906	cytoplasmic vesicle
GO:0005768	0.721	endosome
GO:0071944	0.696	cell periphery
GO:0005769	0.648	early endosome
GO:0005886	0.616	plasma membrane
GO:0042995	0.499	cell projection
GO:0031090	0.471	organelle membrane
GO:0030139	0.355	endocytic vesicle
GO:0030136	0.335	clathrin-coated vesicle
GO:0030424	0.322	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:30735	0.617	1D-myo-inositol 4-phosphate + H2O = myo-inositol + phosphate
EC:3.1.3.25	0.617	inositol-phosphate phosphatase.

[back to server]