StarFunc result for job id Q9Y2H5

User Input

>input (1048 residues)
MSNKTGGKRPATTNSDIPNHNMVSEVPPERPSVRATRTARKAVAFGKRSHSMKRNPNAPV
TKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNI
SRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQIPPAQKSVPQAVRHSHEKPD
SENVPPSKHHQQPPHNSLPKPEPEAKTRGEGDGRGCEKAERRPERPEVKKEPPVKANGLP
AGPEPASEPGSPYPEGPRVPGGGEQPAQPNGWQYHSPSRPGSTAFPSQDGETGGHRRSFP
PRTNPDKIAQRKSSMNQLQQWVNLRRGVPPPEDLRSPSRFYPVSRRVPEYYGPYSSQYPD
DYQYYPPGVRPESICSMPAYDRISPPWALEDKRHAFRNGGGPAYQLREWKEPASYGRQDA
TVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSAR
FERLPPRSEDIYADPAAYVMRRSISSPKVPPYPEVFRDSLHTYKLNEQDTDKLLGKLCEQ
NKVVREQDRLVQQLRAEKESLESALMGTHQELEMFGSQPAYPEKLRHKKDSLQNQLINIR
VELSQATTALTNSTIEYEHLESEVSALHDDLWEQLNLDTQNEVLNRQIQKEIWRIQDVME
GLRKNNPSRGTDTAKHRGGLGPSATYSSNSPASPLSSASLTSPLSPFSLVSGSQGSPTKP
GSNEPKANYEQSKKDPHQTLPLDTPRDISLVPTRQEVEAEKQAALNKVGVVPPRTKSPTD
DEVTPSAVVRRNASGLTNGLSSQERPKSAVFPGEGKVKMSVEEQIDRMRRHQSGSMREKR
RSLQLPASPAPDPSPRPAYKVVRRHRSIHEVDISNLEAALRAEEPGGHAYETPREEIARL
RKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQKKVERIKTLIAK
SSMQNVVPIGEGDSVDVPQDSESQLQEQEKRIEISCALATEASRRGRMLSVQCATPSPPT
SPASPAPPANPLSSESPRGADSSYTMRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2H5	0.999	0.999	0.000	1048	1.000	1.000	Q9Y2H5.pdb.gz	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
2	AFDB:B6RSP1	0.159	0.143	1.444E-38	1197	0.299	0.261	B6RSP1.pdb.gz	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
3	AFDB:E9PKC0	0.175	0.149	2.886E-37	1271	0.313	0.258	E9PKC0.pdb.gz	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
4	AFDB:B4DJX4	0.196	0.208	2.744E-33	977	0.281	0.302	B4DJX4.pdb.gz	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
5	AFDB:A0A024RAY7	0.176	0.161	7.022E-33	1174	0.297	0.265	A0A024RAY7.pdb.gz
6	AFDB:Q9HAU0	0.200	0.190	7.446E-33	1116	0.288	0.271	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
7	AFDB:Q7KNQ9	0.090	0.062	2.282E-9	1557	0.157	0.106	Q7KNQ9.pdb.gz	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
8	AFDB:Q9UQC2	0.110	0.159	2.887E-9	676	0.125	0.194	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
9	PDB:6bbpA	0.089	0.176	5.035E-8	520	0.030	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
10	AFDB:D3ZAL7	0.095	0.139	7.735E-8	693	0.116	0.176	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
11	PDB:3ljuX	0.095	0.255	8.054E-8	373	0.025	0.070	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	AFDB:Q9QYY0	0.096	0.138	1.979E-7	695	0.111	0.167	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
13	PDB:6hhgA	0.082	0.215	7.072E-7	386	0.028	0.075	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
14	PDB:6u3eA	0.079	0.205	8.434E-7	397	0.031	0.081	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:7rx9A	0.081	0.190	1.185E-5	432	0.024	0.058	7rx9A.pdb.gz
16	PDB:6s9wA	0.080	0.199	1.332E-5	411	0.026	0.066	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:4mt6A	0.088	0.226	2.010E-5	389	0.021	0.057	4mt6A.pdb.gz
18	PDB:4mk0A	0.090	0.146	3.409E-5	631	0.017	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:4iapA	0.068	0.265	4.515E-4	256	0.015	0.062	4iapA.pdb.gz
20	PDB:4uudC	0.085	0.638	6.422E-4	113	0.024	0.221	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2H5	0.0	2133	1048	1.000	1.000	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
2	Q9HAU0	2.20e-121	401	1116	0.309	0.290	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
3	B4DJX4	4.61e-121	397	977	0.316	0.339	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
4	A0A0N4SUU0	1.11e-106	357	956	0.288	0.316	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
5	A0JP02	2.64e-71	257	874	0.244	0.293	A0JP02_HUMAN PLEKHA5 protein OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
6	B6RSP1	5.25e-70	257	1197	0.209	0.183	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
7	A0A0N4SUV0	1.25e-66	235	525	0.156	0.310	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
8	A0A0N4SW19	5.41e-66	234	531	0.153	0.301	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
9	A0A0N4SWD7	4.66e-65	240	1000	0.156	0.163	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
10	Q6ZPK1	9.20e-64	238	1205	0.153	0.133	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
11	E9Q6H8	1.22e-63	238	1269	0.153	0.126	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
12	D3ZRT6	2.29e-62	234	1190	0.205	0.181	D3ZRT6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=3
13	Q8CIA7	6.33e-60	223	853	0.236	0.290	Q8CIA7_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
14	A0A0N4SUY3	2.77e-57	212	668	0.202	0.317	A0A0N4SUY3_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
15	A0A0N4SWF5	1.84e-56	212	770	0.211	0.287	A0A0N4SWF5_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	A0A1B0GTN9	2.99e-55	212	1192	0.151	0.133	A0A1B0GTN9_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
17	E9PKC0	6.29e-55	211	1271	0.151	0.124	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
18	Q6IQ23	1.31e-54	209	1121	0.151	0.141	PKHA7_HUMAN Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2
19	Q3UIL6	9.29e-49	191	1118	0.198	0.185	PKHA7_MOUSE Pleckstrin homology domain-containing family A member 7 OS=Mus musculus OX=10090 GN=Plekha7 PE=1 SV=2
20	A0A0N4SV65	2.41e-47	182	662	0.186	0.295	A0A0N4SV65_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.8e-17	75.1	PH domain
2	PF15413 PH_11	6.6e-05	34.7	Pleckstrin homology domain
3	PF16652 PH_13	29	16.0	Pleckstrin homology domain
4	PF20399 PH_20	23	16.5	PH domain
5	PF14593 PH_3	2.6e+02	13.1	PH domain
6	PF15409 PH_8	0.12	24.0	Pleckstrin homology domain
7	PF15410 PH_9	15	17.2	Pleckstrin homology domain
8	PF10486 PI3K_1B_p101	1e+02	12.1	Phosphoinositide 3-kinase gamma adapter protein p101 subunit
9	PF12718 Tropomyosin_1	7.1e+02	11.8	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272203

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308535	0.861	Vesicle transport protein GOT1A
2	9606.ENSP00000356169	0.786	Ethanolamine kinase 2
3	9606.ENSP00000293350	0.752	Aldehyde dehydrogenase 16 family member A1
4	9606.ENSP00000356156	0.751	Protein phosphatase 1 regulatory subunit 15B
5	9606.ENSP00000262265	0.729	PIH1 domain-containing protein 1
6	9606.ENSP00000358802	0.721	Potassium voltage-gated channel subfamily C member 4
7	9606.ENSP00000229314	0.705	Vesicle transport protein GOT1B
8	9606.ENSP00000477344	0.692	Synaptotagmin-6
9	9606.ENSP00000356155	0.665	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
10	9606.ENSP00000256969	0.652	Spexin
11	9606.ENSP00000261195	0.618	Glycogen [starch] synthase, liver
12	9606.ENSP00000476755	0.608	Protein phosphatase 1 regulatory subunit 12B
13	9606.ENSP00000234313	0.580	Pleckstrin
14	9606.ENSP00000272198	0.578	Liprin-alpha-4
15	9606.ENSP00000292476	0.576	Cleavage and polyadenylation specificity factor subunit 4
16	9606.ENSP00000349678	0.573	Myosin-binding protein H-like
17	9606.ENSP00000255416	0.557	Myosin-binding protein H
18	9606.ENSP00000352121	0.554	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
19	9606.ENSP00000356162	0.533	Metastasis-suppressor KiSS-1
20	9606.ENSP00000263265	0.530	Pleckstrin homology domain-containing family A member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.968	biological regulation
GO:0050789	0.876	regulation of biological process
GO:0009987	0.827	cellular process
GO:0050794	0.775	regulation of cellular process
GO:0032501	0.766	multicellular organismal process
GO:0003008	0.469	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005829	0.999	cytosol
GO:0031981	0.989	nuclear lumen
GO:0030054	0.960	cell junction
GO:0005654	0.960	nucleoplasm
GO:0016020	0.928	membrane
GO:0032991	0.740	protein-containing complex
GO:0005886	0.422	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]