StarFunc result for job id Q9Y2H6

User Input

>input (1198 residues)
MAEHPPLLDTTQILSSDISLLSAPIVSADGTQQVILVQVNPGEAFTIRREDGQFQCITGP
AQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPHPPLP
GFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSS
KTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSG
KGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGETDES
SVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSE
AEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQC
YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLTKAGI
TWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKV
IAYNSEGKSNPSEVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYV
VEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAV
PPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVEC
TVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWE
VPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPF
SEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFG
DKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECV
AFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNESTSYK
FCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIY
SLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTT
VLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFVIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LGL5	0.436	0.431	0.000	1215	0.573	0.565	A0A140LGL5.pdb.gz
2	AFDB:Q8BX90	0.485	0.485	0.000	1198	0.910	0.910	Q8BX90.pdb.gz	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
3	AFDB:B7YZW3	0.298	0.189	4.324E-85	2064	0.312	0.181	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
4	AFDB:F1QJW2	0.197	0.132	1.011E-48	1918	0.159	0.100	F1QJW2.pdb.gz
5	AFDB:A0A0B4K6Z6	0.244	0.154	4.796E-35	2037	0.132	0.078	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
6	AFDB:Q90933	0.127	0.120	2.725E-30	1280	0.124	0.116	Q90933.pdb.gz	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:F1R2D2	0.135	0.110	6.205E-21	1687	0.104	0.074	F1R2D2.pdb.gz
8	AFDB:Q9W213	0.151	0.137	2.506E-20	1395	0.120	0.103	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	AFDB:Q9Z2I4	0.143	0.130	7.523E-19	1366	0.102	0.089	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
10	AFDB:Q9VPZ7	0.131	0.119	1.114E-18	1342	0.095	0.085	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
11	PDB:5a42A	0.091	0.076	6.555E-17	1597	0.098	0.073	5a42A.pdb.gz
12	PDB:7q1yA	0.090	0.082	9.058E-15	1374	0.078	0.068	7q1yA.pdb.gz
13	PDB:6h03A	0.090	0.088	2.167E-14	1223	0.073	0.072	6h03A.pdb.gz
14	PDB:7q5zA	0.091	0.084	5.909E-14	1344	0.070	0.062	7q5zA.pdb.gz
15	PDB:5oj2B	0.133	0.206	1.088E-13	692	0.093	0.160	5oj2B.pdb.gz
16	PDB:1e07A	0.227	0.355	1.137E-13	642	0.069	0.129	1e07A.pdb.gz
17	PDB:8eyyA	0.145	0.205	1.774E-12	775	0.048	0.075	8eyyA.pdb.gz
18	PDB:7nycA	0.086	0.071	3.128E-12	1542	0.064	0.050	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:6pxvA	0.148	0.201	4.245E-12	823	0.046	0.067	6pxvA.pdb.gz
20	PDB:4ziqA	0.089	0.077	4.838E-12	1450	0.088	0.072	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53EP0	0.0	1161	1204	0.513	0.510	FND3B_HUMAN Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B PE=1 SV=2
2	Q6NWW9	0.0	1121	1207	0.502	0.498	FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
3	Q8BX90	0.0	2270	1198	0.911	0.911	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
4	Q9Y2H6	0.0	2477	1198	1.000	1.000	FND3A_HUMAN Fibronectin type-III domain-containing protein 3A OS=Homo sapiens OX=9606 GN=FNDC3A PE=1 SV=4
5	Q9VJJ8	6.23e-134	445	1413	0.285	0.242	Q9VJJ8_DROME LD30602p OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=2
6	Q9VJJ9	3.96e-132	445	1762	0.285	0.194	Q9VJJ9_DROME FI20237p1 OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=4
7	M9PD19	4.83e-132	445	1779	0.285	0.192	M9PD19_DROME Miles to go, isoform H OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
8	B7YZW3	3.80e-131	445	2064	0.286	0.166	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	A2ASS6	7.58e-39	161	35213	0.174	0.006	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
10	A0A8I5ZUN3	1.06e-38	160	35375	0.177	0.006	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
11	A0A8I5ZU83	1.36e-38	160	26931	0.176	0.008	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
12	Q8WZ42	1.61e-38	160	34350	0.173	0.006	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
13	H2FLH3	1.82e-33	144	6848	0.149	0.026	H2FLH3_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1
14	Q23551	2.24e-33	143	7158	0.149	0.025	UNC22_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3
15	H2FLH2	2.29e-33	143	6927	0.149	0.026	H2FLH2_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1
16	A2A8L5	4.14e-29	129	1898	0.144	0.091	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
17	Q7Z5N4	5.91e-29	129	2213	0.192	0.104	SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens OX=9606 GN=SDK1 PE=2 SV=3
18	D1YSG0	7.89e-29	128	8933	0.171	0.023	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
19	L0MN91	8.44e-29	128	8866	0.171	0.023	L0MN91_DROME Bent, isoform I OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
20	P10586	8.54e-29	128	1907	0.141	0.089	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.4e-87	299.5	Fibronectin type III domain
2	PF09294 Interfer-bind	0.0027	29.3	Interferon-alpha/beta receptor, fibronectin type III
3	PF10179 NDNF	6.4e-07	41.0	Neuron-derived neurotrophic factor, first Fn(III) domain
4	PF16656 Pur_ac_phosph_N	6.3e-12	57.3	Purple acid Phosphatase, N-terminal domain
5	PF02014 Reeler	1.9e+02	14.2	Reeler domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479669	0.743	Calcium-binding protein 39-like
2	9606.ENSP00000218721	0.724	Motilin receptor
3	9606.ENSP00000380747	0.718	Transmembrane protein 209
4	9606.ENSP00000367570	0.679	PHD finger protein 11
5	9606.ENSP00000389910	0.676	RCC1 and BTB domain containing protein 2
6	9606.ENSP00000367828	0.652	Integral membrane protein 2B
7	9606.ENSP00000357844	0.646	Monocarboxylate transporter 10
8	9606.ENSP00000365919	0.611	WD repeat-containing protein 13
9	9606.ENSP00000367064	0.607	Cubilin
10	9606.ENSP00000251108	0.593	Cytidine and dCMP deaminase domain-containing protein 1
11	9606.ENSP00000367552	0.580	RCC1 and BTB domain-containing protein 1
12	9606.ENSP00000351346	0.531	Vacuolar protein sorting-associated protein 13B
13	9606.ENSP00000389630	0.525	Probable C-mannosyltransferase DPY19L4
14	9606.ENSP00000305640	0.511	Olfactory receptor 6F1
15	9606.ENSP00000311677	0.503	Nuclear inhibitor of protein phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0048856	0.966	anatomical structure development
GO:0032501	0.895	multicellular organismal process
GO:0007275	0.887	multicellular organism development
GO:0030154	0.866	cell differentiation
GO:0065007	0.612	biological regulation
GO:0048731	0.610	system development
GO:0050789	0.514	regulation of biological process
GO:0009888	0.480	tissue development
GO:0048513	0.461	animal organ development
GO:0050794	0.447	regulation of cellular process
GO:0030855	0.418	epithelial cell differentiation
GO:0045137	0.409	development of primary sexual characteristics
GO:0061458	0.376	reproductive system development
GO:0008584	0.368	male gonad development
GO:0019953	0.360	sexual reproduction
GO:0048468	0.330	cell development
GO:0007155	0.301	cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0016020	0.999	membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.586	cytosol
GO:0031982	0.514	vesicle
GO:0005794	0.310	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]