StarFunc result for job id Q9Y2H9

User Input

>input (1570 residues)
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEG
RSSKAKKPPGENDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRNQIQQAF
VERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYFAE
TVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKDAR
EFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVI
SDDILWPEGDEALPTEAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQKA
EFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSMEQ
LSQHEPKTPVAAAGSSKREPSTKGPEEKVAGKREGLGGLTLREKTWRGGSPEIKRFSASE
ASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDEARLRRPPRPSSDPAGSLDARAPKE
ETQGEGTSSAGDSEATDRPRPGDLCPPSKDGDASGPRATNDLVLRRARHQQMSGDVAVEK
RPSRTGGKVIKSASATALSVMIPAVDPHGSSPLASPMSPRSLSSNPSSRDSSPSRDYSPA
VSGLRSPITIQRSGKKYGFTLRAIRVYMGDTDVYSVHHIVWHVEEGGPAQEAGLCAGDLI
THVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNKRP
SAKEGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPARSPTHS
YRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKSAG
NIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRSPL
LKRVQSAEKLGASLSADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPVEGL
GAPRQVAVRRLGRQESPLSLGADPLLPEGASRPPVSSKEKESPGGAEACTPPRATTPGGR
TLERDVGCTRHQSVQTEDGTGGMARAVAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEP
ARPGAKAVVPQPLGADSKGLQEPAPLAPSVPEAPRGRERWVLEVVEERTTLSGPRSKPAS
PKLSPEPQTPSLAPAKCSAPSSAVTPVPPASLLGSGTKPQVGLTSRCPAEAVPPAGLTKK
GVSSPAPPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60592	0.433	0.395	0.000	1734	0.618	0.559	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
2	AFDB:Q6P0Q8	0.496	0.439	0.000	1798	0.618	0.539	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
3	AFDB:Q9R1L5	0.536	0.536	0.000	1570	0.943	0.943	Q9R1L5.pdb.gz	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
4	AFDB:Q9VUQ9	0.254	0.193	1.430E-84	2139	0.413	0.303	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
5	AFDB:F1MYJ4	0.199	0.633	1.012E-29	479	0.088	0.288	F1MYJ4.pdb.gz	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
6	PDB:6byrA	0.181	0.687	9.375E-26	405	0.082	0.316	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
7	PDB:5x3fB	0.169	0.724	1.535E-23	349	0.078	0.352	5x3fB.pdb.gz
8	PDB:3c4wB	0.172	0.511	3.339E-23	519	0.078	0.235	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
9	PDB:6pjxA	0.194	0.539	4.055E-23	543	0.089	0.256	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
10	PDB:3pfqA	0.172	0.508	8.818E-23	523	0.067	0.201	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
11	PDB:3nynA	0.195	0.533	1.827E-22	554	0.081	0.229	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
12	PDB:3pvuA	0.177	0.438	4.378E-22	609	0.080	0.205	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	AFDB:H2KYA5	0.168	0.148	4.571E-22	1793	0.180	0.157	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
14	AFDB:Q9W532	0.166	0.185	8.593E-22	1398	0.158	0.177	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
15	PDB:5dykA	0.173	0.331	9.069E-22	809	0.063	0.122	5dykA.pdb.gz
16	PDB:4mk0A	0.182	0.433	1.156E-21	631	0.083	0.206	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	AFDB:Q9Y2K2	0.170	0.200	2.162E-21	1321	0.159	0.188	Q9Y2K2.pdb.gz	SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=4
18	PDB:4yhjA	0.170	0.519	2.173E-21	501	0.078	0.246	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	AFDB:O00444	0.172	0.271	1.159E-19	970	0.106	0.172	O00444.pdb.gz	PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=3
20	AFDB:A1ZBC4	0.162	0.173	1.628E-19	1471	0.149	0.159	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60307	0.0	1058	1309	0.332	0.399	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
2	Q60592	0.0	1611	1734	0.582	0.527	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
3	Q6P0Q8	0.0	1649	1798	0.580	0.506	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
4	Q9R1L5	0.0	2852	1570	0.944	0.944	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
5	Q9Y2H9	0.0	3187	1570	1.000	1.000	MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2
6	Q9VUQ9	2.60e-162	544	2139	0.159	0.116	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
7	Q9LE81	5.59e-93	330	1168	0.117	0.158	IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana OX=3702 GN=IRE PE=2 SV=1
8	F4HYG2	1.07e-87	315	1235	0.101	0.129	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
9	F4J6F6	1.14e-86	313	1296	0.100	0.121	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
10	Q8I4W3	3.81e-67	244	735	0.075	0.161	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
11	P47197	3.76e-66	234	481	0.084	0.274	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
12	E1B9D1	6.44e-66	233	438	0.083	0.297	E1B9D1_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT2 PE=3 SV=2
13	P68181	1.08e-65	229	351	0.078	0.348	KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus OX=10090 GN=Prkacb PE=1 SV=2
14	P68182	1.08e-65	229	351	0.078	0.348	KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus OX=10116 GN=Prkacb PE=1 SV=2
15	G1SK25	1.27e-65	228	338	0.079	0.367	G1SK25_RABIT cAMP-dependent protein kinase OS=Oryctolagus cuniculus OX=9986 GN=PRKACB PE=3 SV=3
16	F1SD45	1.32e-65	228	351	0.080	0.356	F1SD45_PIG cAMP-dependent protein kinase OS=Sus scrofa OX=9823 GN=PRKACA PE=3 SV=1
17	P36887	1.66e-65	228	351	0.080	0.356	KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa OX=9823 GN=PRKACA PE=1 SV=4
18	P17612	2.02e-65	228	351	0.080	0.356	KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2
19	M0R0P9	2.21e-65	231	450	0.078	0.273	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
20	A0A0B8RZS0	2.60e-65	232	481	0.083	0.270	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.32	21.6	ABC1 atypical kinase-like domain
2	PF01636 APH	0.29	22.5	Phosphotransferase enzyme family
3	PF08926 DUF1908	1.8e-134	458.8	Domain of unknown function (DUF1908)
4	PF06293 Kdo	6.8e+02	11.0	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	3.2	18.6	Kinase-like
6	PF00595 PDZ	2.1e-06	39.3	PDZ domain
7	PF13180 PDZ_2	0.024	26.3	PDZ domain
8	PF17820 PDZ_6	2.2e-07	42.0	PDZ domain
9	PF02163 Peptidase_M50	0.22	22.4	Peptidase family M50
10	PF00069 Pkinase	6.2e-57	204.5	Protein kinase domain
11	PF17667 Pkinase_fungal	3.5e+02	11.3	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	2.3e-21	87.8	Protein tyrosine and serine/threonine kinase
13	PF01163 RIO1	55	14.8	RIO1 family
14	PF14685 Tricorn_PDZ	27	16.2	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455625	0.777	cAMP-regulated phosphoprotein 19
2	9606.ENSP00000346151	0.756	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
3	9606.ENSP00000351113	0.728	Protein furry homolog-like
4	9606.ENSP00000445043	0.728	Protein furry homolog
5	9606.ENSP00000341743	0.649	Alpha-endosulfine
6	9606.ENSP00000361021	0.643	Phosphatase and tensin homolog
7	9606.ENSP00000354425	0.614	E3 ubiquitin-protein ligase Jade-2
8	9606.ENSP00000354916	0.607	Dual specificity protein phosphatase CDC14A
9	9606.ENSP00000361664	0.601	Transcription factor HIVEP3
10	9606.ENSP00000466248	0.596	Inactive serine/threonine-protein kinase PLK5
11	9606.ENSP00000338191	0.584	Beta-2-syntrophin
12	9606.ENSP00000441823	0.541	Sal-like protein 3
13	9606.ENSP00000298910	0.535	Leucine-rich repeat serine/threonine-protein kinase 2
14	9606.ENSP00000361275	0.508	Serine/threonine-protein kinase PLK3
15	9606.ENSP00000274289	0.507	Serine/threonine-protein kinase PLK2
16	9606.ENSP00000262483	0.504	Membrane-associated phosphatidylinositol transfer protein 3
17	9606.ENSP00000300093	0.504	Serine/threonine-protein kinase PLK1
18	9606.ENSP00000367323	0.500	Voltage-gated potassium channel subunit beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004672	0.997	protein kinase activity
GO:0004674	0.934	protein serine/threonine kinase activity
GO:0008092	0.825	cytoskeletal protein binding
GO:0008017	0.813	microtubule binding
GO:0019899	0.300	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.966	cellular process
GO:0050789	0.813	regulation of biological process
GO:0050794	0.782	regulation of cellular process
GO:0032501	0.770	multicellular organismal process
GO:0060322	0.752	head development
GO:0007417	0.724	central nervous system development
GO:0048513	0.625	animal organ development
GO:0008152	0.583	metabolic process
GO:0007420	0.561	brain development
GO:0071704	0.559	organic substance metabolic process
GO:0044238	0.546	primary metabolic process
GO:0044237	0.545	cellular metabolic process
GO:0006807	0.539	nitrogen compound metabolic process
GO:0043170	0.504	macromolecule metabolic process
GO:1901564	0.453	organonitrogen compound metabolic process
GO:0019222	0.347	regulation of metabolic process
GO:0016043	0.346	cellular component organization
GO:0060255	0.325	regulation of macromolecule metabolic process
GO:0048518	0.319	positive regulation of biological process
GO:0019538	0.315	protein metabolic process
GO:0050896	0.302	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.967	membrane
GO:0043229	0.957	intracellular organelle
GO:0005829	0.893	cytosol
GO:0043231	0.865	intracellular membrane-bounded organelle
GO:0120025	0.755	plasma membrane bounded cell projection
GO:0043005	0.731	neuron projection
GO:0043228	0.640	non-membrane-bounded organelle
GO:0043232	0.633	intracellular non-membrane-bounded organelle
GO:0036477	0.548	somatodendritic compartment
GO:0044297	0.468	cell body
GO:0071944	0.467	cell periphery
GO:0005886	0.460	plasma membrane
GO:0005856	0.382	cytoskeleton
GO:0015630	0.350	microtubule cytoskeleton
GO:0005634	0.310	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.

[back to server]