StarFunc result for job id Q9Y2I1

User Input

>input (1504 residues)
MATARTFGPEREAEPAKEARVVGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKL
VAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFY
EINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHI
LDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKP
TLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVS
EIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGLHTKLGNIKTL
NLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDY
RTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSNPEKKGGEDSRLS
AAPCIRPSSSPPTVAPASASLPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQGC
SDSLESIPAGQAASDDLRDVPGAVGGASPEHAEPEVQVVPGSGQIIFLPFTCIGYTATNQ
DFIQRLSTLIRQAIERQLPAWIEAANQREEGQGEQGEEEDEEEEEEEDVAENRYFEMGPP
DVEEEEGGGQGEEEEEEEEDEEAEEERLALEWALGADEDFLLEHIRILKVLWCFLIHVQG
SIRQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTEFGFLMPELCL
VLKVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLT
FYKVAGGCQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEA
VKSAAIPYWLLLTPQHLNVIKADFNPMPNRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCT
QPRGAFADGHVLELLVGYRFVTAIFVLPHEKFHFLRVYNQLRASLQDLKTVVIAKTPGTG
GSPQGSFADGQPAERRASNDQRPQEVPAEALAPAPAEVPAPAPAAASASGPAKTPAPAEA
STSALVPEETPVEAPAPPPAEAPAQYPSEHLIQATSEENQIPSHLPACPSLRHVASLRGS
AIIELFHSSIAEVENEELRHLMWSSVVFYQTPGLEVTACVLLSTKAVYFVLHDGLRRYFS
EPLQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQHFRLTGSTPMQVVTCLTR
DSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYP
SEEEIGDLTFTVAQKMAEPEKAPALSILLYVQAFQVGMPPPGCCRGPLRPKTLLLTSSEI
FLLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALTLVFDDVQGH
DLMGSVTLDHFGEVPGGPARASQGREVQWQVFVPSAESREKLISLLARQWEALCGRELPV
ELTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G017	0.336	0.336	0.000	1502	0.893	0.894	Q4G017.pdb.gz	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2
2	AFDB:Q80TM9	0.310	0.293	0.000	1593	0.892	0.842	Q80TM9.pdb.gz	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
3	AFDB:Q9Y2I1	1.000	1.000	0.000	1504	1.000	1.000	Q9Y2I1.pdb.gz	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
4	AFDB:C9J715	0.317	0.803	1.257E-85	583	0.346	0.892	C9J715.pdb.gz	C9J715_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=1
5	AFDB:Q9CZ62	0.122	0.209	4.041E-9	856	0.059	0.103	Q9CZ62.pdb.gz	CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus OX=10090 GN=Cep97 PE=1 SV=1
6	AFDB:Q55CS7	0.115	0.193	1.090E-8	834	0.060	0.108	Q55CS7.pdb.gz	MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum OX=44689 GN=mpl1 PE=2 SV=1
7	AFDB:A0A140VJN4	0.099	0.202	1.745E-8	725	0.061	0.127	A0A140VJN4.pdb.gz	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1
8	PDB:6hkwA	0.110	0.411	3.471E-8	306	0.037	0.180	6hkwA.pdb.gz
9	AFDB:Q9XHH2	0.100	0.725	9.285E-8	198	0.027	0.202	Q9XHH2.pdb.gz	DNAL1_CHLRE Dynein axonemal light chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=LC1 PE=1 SV=1
10	AFDB:Q8IB59	0.099	0.708	2.257E-7	199	0.026	0.196	Q8IB59.pdb.gz	Q8IB59_PLAF7 Dynein light chain 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0822500 PE=4 SV=1
11	AFDB:Q5VUJ6	0.111	0.203	1.405E-6	765	0.055	0.107	Q5VUJ6.pdb.gz	LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRCH2 PE=1 SV=2
12	PDB:1m9sA	0.107	0.299	1.657E-6	523	0.031	0.088	1m9sA.pdb.gz
13	PDB:7tvfD	0.125	0.329	1.207E-5	515	0.040	0.117	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:6zxdk	0.117	0.345	3.808E-5	430	0.039	0.137	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
15	PDB:6gffI	0.107	0.274	6.765E-5	551	0.035	0.096	6gffI.pdb.gz
16	PDB:6m04A	0.109	0.170	1.334E-4	714	0.048	0.101	6m04A.pdb.gz
17	PDB:3t6qA	0.112	0.253	2.135E-4	601	0.035	0.088	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:3jb9j	0.082	0.710	3.078E-4	160	0.018	0.169	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:3ljuX	0.069	0.203	3.243E-4	373	0.018	0.072	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:7lt9A	0.094	0.491	3.243E-4	251	0.029	0.175	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J715	0.0	1028	583	0.339	0.875	C9J715_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=1
2	Q4G017	0.0	2613	1502	0.886	0.887	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2
3	Q80TM9	0.0	1834	1593	0.633	0.598	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
4	Q9Y2I1	0.0	3091	1504	1.000	1.000	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
5	Q8N1F8	4.98e-19	96.3	1088	0.058	0.080	S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4
6	B4DKM2	1.70e-18	92.0	396	0.058	0.220	B4DKM2_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q8IW35	2.94e-12	73.9	865	0.057	0.099	CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1
8	Q14160	3.53e-12	74.3	1630	0.049	0.045	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
9	A0A669KB89	3.63e-12	74.3	1658	0.049	0.045	A0A669KB89_HUMAN Scribble planar cell polarity protein OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
10	D3ZWS0	4.01e-12	73.9	1638	0.049	0.045	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
11	A0A8I6ANK4	5.25e-12	73.6	1589	0.049	0.047	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
12	A2AL36	5.33e-12	73.6	2334	0.029	0.018	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
13	A0A8I6ABB5	5.91e-12	73.6	1589	0.049	0.047	A0A8I6ABB5_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
14	A0A8I6APB3	6.24e-12	73.6	1610	0.049	0.046	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
15	Q80U72	7.64e-12	73.2	1612	0.049	0.046	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
16	Q38BT2	1.53e-11	71.6	630	0.034	0.081	Q38BT2_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4360 PE=4 SV=1
17	Q9D5S7	2.45e-11	71.2	820	0.032	0.059	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1
18	Q9JJ28	1.04e-10	69.3	1271	0.043	0.050	FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus OX=10090 GN=Flii PE=1 SV=1
19	Q7Z7A1	1.98e-10	68.6	2325	0.028	0.018	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
20	Q380Y7	2.27e-10	68.2	1004	0.031	0.046	Q380Y7_TRYB2 AMP-activated protein kinase glycogen-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8770 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	2.5e-11	54.8	Leucine Rich repeats (2 copies)
2	PF13855 LRR_8	5.8e-08	43.7	Leucine rich repeat
3	PF14580 LRR_9	0.00025	32.2	Leucine-rich repeat
4	PF00787 PX	4.5e-11	54.6	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339958

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293379	0.860	Integrin alpha-5
2	9606.ENSP00000447149	0.818	Bile acid receptor
3	9606.ENSP00000283195	0.748	E3 SUMO-protein ligase RanBP2
4	9606.ENSP00000324856	0.727	Serine/threonine-protein kinase STK11
5	9606.ENSP00000278568	0.716	Serine/threonine-protein kinase PAK 1
6	9606.ENSP00000401470	0.664	Ran GTPase-activating protein 1
7	9606.ENSP00000336740	0.654	LIM domain kinase 1
8	9606.ENSP00000312411	0.646	Protein phosphatase 1E
9	9606.ENSP00000376077	0.646	Small ubiquitin-related modifier 1
10	9606.ENSP00000419485	0.642	Germinal center-associated signaling and motility protein
11	9606.ENSP00000410689	0.635	Actin filament-associated protein 1
12	9606.ENSP00000380432	0.629	Insulin
13	9606.ENSP00000410452	0.624	Stathmin
14	9606.ENSP00000475915	0.621	Connector enhancer of kinase suppressor of ras 3
15	9606.ENSP00000244745	0.609	Transcription factor SOX-4
16	9606.ENSP00000233575	0.592	Sorting nexin-17
17	9606.ENSP00000381364	0.581	Calcineurin-binding protein cabin-1
18	9606.ENSP00000380553	0.577	Tetraspanin-4
19	9606.ENSP00000445408	0.573	Rab GTPase-binding effector protein 1
20	9606.ENSP00000481912	0.567	Carbohydrate sulfotransferase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0023052	0.969	signaling
GO:0007154	0.959	cell communication
GO:0050896	0.750	response to stimulus
GO:0051179	0.632	localization
GO:0051234	0.533	establishment of localization
GO:0008152	0.523	metabolic process
GO:0071704	0.510	organic substance metabolic process
GO:0006810	0.493	transport
GO:0051716	0.486	cellular response to stimulus
GO:0044238	0.457	primary metabolic process
GO:0048519	0.450	negative regulation of biological process
GO:0007165	0.444	signal transduction
GO:0048523	0.434	negative regulation of cellular process
GO:0071840	0.391	cellular component organization or biogenesis
GO:0016043	0.346	cellular component organization
GO:0010646	0.345	regulation of cell communication
GO:0023051	0.342	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005886	0.989	plasma membrane
GO:0005856	0.714	cytoskeleton
GO:0015630	0.643	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]