StarFunc result for job id Q9Y2I6

User Input

>input (1382 residues)
MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFAR
VNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDA
ATEARRVPEQQTQASLKSHLWRSASLESVESPKSDEEAESTKEAQNELFEAQGQLQTWDS
EDFGSPQKSCSPSFDTPESQIRGVWEELGVGSSGHLSEQELAVVCQSVGLQGLEKEELED
LFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPSKAWSHYQVPEESGCHTTTTS
SLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSVDEKVNLLELT
WALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARERDKARQDLERAEKRNLEFVKE
MDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEAERELFWEQAHRQRAALEWDVGRLQ
AEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKDKLEPQSAEL
LAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGL
GPAGISFLGNSAPVSIETELMMEQVKEHYQDLRTQLETKVNYYEREIAALKRNFEKERKD
MEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALC
GLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLE
LERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQ
EGTRGLLPLRPGCGERPLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASH
GPSERWSRMQPCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEP
PLRPAASCRGQAERLQAIQEERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRG
SLPSHLQLADPQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVVRALEKHVDLRE
NDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEKACSEMEVLNR
QNQNYKDQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRSGQQQSDQIQK
LRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVA
ELHRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQF
EKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAAL
SV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2I6	1.000	1.000	0.000	1382	1.000	1.000	Q9Y2I6.pdb.gz	NINL_HUMAN Ninein-like protein OS=Homo sapiens OX=9606 GN=NINL PE=1 SV=2
2	AFDB:A0A0G2LAC3	0.163	0.172	4.188E-52	1303	0.349	0.371	A0A0G2LAC3.pdb.gz
3	AFDB:Q61043	0.159	0.110	1.268E-31	2113	0.296	0.194	Q61043.pdb.gz	NIN_MOUSE Ninein OS=Mus musculus OX=10090 GN=Nin PE=1 SV=4
4	AFDB:Q8N4C6	0.199	0.143	3.522E-31	2090	0.258	0.171	Q8N4C6.pdb.gz	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
5	AFDB:I3ISQ9	0.152	0.114	1.256E-22	1954	0.245	0.173	I3ISQ9.pdb.gz
6	AFDB:Q8MMD2	0.083	0.091	6.091E-6	1232	0.103	0.116	Q8MMD2.pdb.gz	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
7	AFDB:Q9U2T9	0.086	0.103	8.090E-6	1085	0.109	0.139	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
8	AFDB:Q5JRA6	0.092	0.069	3.963E-5	1907	0.119	0.086	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
9	PDB:2f2pA	0.050	0.321	5.342E-5	169	0.025	0.207	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
10	PDB:5d43A	0.047	0.368	1.862E-4	150	0.023	0.213	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
11	PDB:4e53A	0.053	0.328	2.207E-4	168	0.025	0.202	4e53A.pdb.gz
12	AFDB:Q382T5	0.079	0.101	2.729E-4	1026	0.101	0.135	Q382T5.pdb.gz	Q382T5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4300 PE=4 SV=1
13	AFDB:A0A0B4J1F9	0.100	0.088	4.814E-4	1599	0.151	0.130	A0A0B4J1F9.pdb.gz	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
14	PDB:5a2hA	0.047	0.390	4.886E-4	147	0.024	0.224	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:1a2xA	0.049	0.375	6.489E-4	158	0.020	0.171	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
16	PDB:2n6aA	0.051	0.333	1.282E-3	162	0.022	0.191	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
17	PDB:3fwbA	0.048	0.378	1.520E-3	153	0.022	0.203	3fwbA.pdb.gz
18	PDB:1ggzA	0.045	0.338	1.609E-3	144	0.025	0.243	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
19	PDB:3qrxA	0.048	0.350	1.609E-3	145	0.022	0.214	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
20	PDB:3f45A	0.048	0.512	1.703E-3	109	0.014	0.174	3f45A.pdb.gz	Removing the invariant salt bridge of parvalbumin increases flexibility in the AB-loop structure

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2I6	0.0	2770	1382	1.000	1.000	NINL_HUMAN Ninein-like protein OS=Homo sapiens OX=9606 GN=NINL PE=1 SV=2
2	G9G127	1.34e-176	562	1303	0.245	0.260	NINL_DANRE Ninein-like protein OS=Danio rerio OX=7955 GN=Ninl PE=1 SV=1
3	Q61043	8.50e-119	413	2113	0.200	0.131	NIN_MOUSE Ninein OS=Mus musculus OX=10090 GN=Nin PE=1 SV=4
4	E9PN67	3.63e-118	411	1989	0.198	0.138	E9PN67_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
5	C9J066	3.90e-118	411	2046	0.198	0.134	C9J066_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
6	Q8N4C6	6.65e-118	410	2090	0.198	0.131	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
7	F1QE08	5.81e-86	310	1379	0.173	0.173	F1QE08_DANRE Ninein (GSK3B-interacting protein) OS=Danio rerio OX=7955 GN=nin PE=4 SV=2
8	H9KV85	8.22e-15	82.8	1581	0.046	0.040	H9KV85_HUMAN Ninein (Fragment) OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
9	P11929	2.78e-09	64.3	820	0.055	0.093	BSG2_DROME Blastoderm-specific protein 25D OS=Drosophila melanogaster OX=7227 GN=Bsg25D PE=1 SV=3
10	Q9JM83	0.006	41.2	148	0.016	0.149	CALM4_MOUSE Calmodulin-4 OS=Mus musculus OX=10090 GN=Calm4 PE=2 SV=2
11	P34216	0.025	41.6	1381	0.053	0.053	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
12	Q86YS3	0.074	40.0	637	0.020	0.044	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
13	P59242	0.17	38.9	1191	0.048	0.056	CING_MOUSE Cingulin OS=Mus musculus OX=10090 GN=Cgn PE=1 SV=1
14	Q3LGD4	0.20	38.5	621	0.017	0.037	RFP4A_DANRE Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1
15	Q9P2M7	0.20	38.5	1203	0.048	0.055	CING_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=3
16	B9EK46	0.21	38.5	1203	0.048	0.055	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
17	P60469	0.60	37.0	1194	0.025	0.028	LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=Ppfia3 PE=1 SV=2
18	O75145	0.70	37.0	1194	0.025	0.028	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
19	O95153	0.77	37.0	1857	0.030	0.023	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
20	Q60902	0.80	36.6	907	0.030	0.045	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09493 DUF2389	4e+02	13.0	Tryptophan-rich protein (DUF2389)
2	PF00036 EF-hand_1	5.8e-08	42.8	EF hand
3	PF13202 EF-hand_5	0.001	29.6	EF hand
4	PF13405 EF-hand_6	7.9e-07	39.4	EF-hand domain
5	PF13499 EF-hand_7	2.5e-11	55.2	EF-hand domain pair
6	PF13833 EF-hand_8	4.5e-05	34.5	EF-hand domain pair
7	PF07676 PD40	7.5e+02	11.5	WD40-like Beta Propeller Repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300093	0.979	Serine/threonine-protein kinase PLK1
2	9606.ENSP00000251413	0.972	Tubulin gamma-1 chain
3	9606.ENSP00000376686	0.867	Lebercilin
4	9606.ENSP00000305941	0.818	Usherin
5	9606.ENSP00000418960	0.761	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000403465	0.687	Coiled-coil and C2 domain-containing protein 2A
7	9606.ENSP00000416015	0.663	[F-actin]-monooxygenase MICAL3
8	9606.ENSP00000459043	0.648	BICD family-like cargo adapter 2
9	9606.ENSP00000370021	0.631	Centlein
10	9606.ENSP00000354623	0.606	Whirlin
11	9606.ENSP00000265978	0.602	FTS and Hook-interacting protein
12	9606.ENSP00000380661	0.590	Centrosome-associated protein CEP250
13	9606.ENSP00000484472	0.590	Epiplakin
14	9606.ENSP00000260383	0.587	Gamma-tubulin complex component 4
15	9606.ENSP00000304188	0.581	Olfactory receptor 8U1
16	9606.ENSP00000267273	0.570	Protein-lysine methyltransferase METTL21C
17	9606.ENSP00000479542	0.555	Centrosomal protein kizuna
18	9606.ENSP00000344314	0.544	Oral-facial-digital syndrome 1 protein
19	9606.ENSP00000384582	0.539	G-protein coupled receptor 98
20	9606.ENSP00000354791	0.538	Dynactin subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071840	0.966	cellular component organization or biogenesis
GO:0016043	0.960	cellular component organization
GO:0065007	0.860	biological regulation
GO:0050789	0.761	regulation of biological process
GO:0006996	0.698	organelle organization
GO:0050794	0.607	regulation of cellular process
GO:0032501	0.443	multicellular organismal process
GO:0000226	0.365	microtubule cytoskeleton organization
GO:0032502	0.356	developmental process
GO:0051179	0.339	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0005829	0.999	cytosol
GO:0045171	0.964	intercellular bridge
GO:0043227	0.958	membrane-bounded organelle
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0032991	0.915	protein-containing complex
GO:0070013	0.800	intracellular organelle lumen
GO:0005634	0.778	nucleus
GO:0005815	0.775	microtubule organizing center
GO:0005654	0.688	nucleoplasm
GO:0012505	0.445	endomembrane system
GO:0005813	0.442	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]