StarFunc result for job id Q9Y2I7

User Input

>input (2098 residues)
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSA
CSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWK
KICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHST
TACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQ
DDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDY
FAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAE
HLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICK
QVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASF
SYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFS
KTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDR
FLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKE
KSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKA
SGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGG
KSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIG
YKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLL
KMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRT
FTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QAJ5	0.547	0.545	0.000	2105	0.704	0.702	A0A2R8QAJ5.pdb.gz
2	AFDB:Q9Y2I7	1.000	1.000	0.000	2098	1.000	1.000	Q9Y2I7.pdb.gz	FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3
3	AFDB:G5ED98	0.451	0.618	6.306E-93	1497	0.232	0.325	G5ED98.pdb.gz	G5ED98_CAEEL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Caenorhabditis elegans OX=6239 GN=ppk-3 PE=1 SV=1
4	AFDB:P34756	0.413	0.382	1.714E-92	2278	0.245	0.226	P34756.pdb.gz	FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAB1 PE=1 SV=3
5	AFDB:A0A1D8PGH4	0.423	0.342	7.620E-89	2624	0.235	0.188	A0A1D8PGH4.pdb.gz	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
6	AFDB:B0G126	0.371	0.299	1.173E-81	2656	0.256	0.202	B0G126.pdb.gz	FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum OX=44689 GN=pip5k3 PE=3 SV=1
7	PDB:7nvmg	0.111	0.408	2.161E-19	538	0.034	0.132	7nvmg.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
8	PDB:5gw4G	0.107	0.403	3.215E-18	518	0.041	0.164	5gw4G.pdb.gz
9	PDB:7nvnb	0.108	0.399	4.105E-16	527	0.028	0.112	7nvnb.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
10	PDB:7nvme	0.109	0.394	4.770E-16	540	0.027	0.106	7nvme.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
11	PDB:6ks6b	0.106	0.395	5.527E-15	518	0.029	0.118	6ks6b.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
12	PDB:6krdg	0.104	0.407	6.751E-15	493	0.040	0.168	6krdg.pdb.gz
13	PDB:7nvmH	0.108	0.396	6.751E-15	528	0.029	0.114	7nvmH.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
14	PDB:4xcdA	0.107	0.408	1.113E-14	507	0.033	0.136	4xcdA.pdb.gz	Structural and Functional Insights into the Evolution and Stress Adaptation of Type II Chaperonins.
15	PDB:3j1fA	0.105	0.392	2.356E-14	505	0.032	0.133	3j1fA.pdb.gz	Flexible interwoven termini determine the thermal stability of thermosomes.
16	PDB:7nvmD	0.110	0.411	3.695E-14	520	0.024	0.098	7nvmD.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
17	AFDB:Q38BL1	0.115	0.255	6.448E-8	891	0.051	0.119	Q38BL1.pdb.gz	Q38BL1_TRYB2 Phosphatidylinositol-4-phosphate 5-kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3440 PE=4 SV=1
18	AFDB:Q9U263	0.031	0.035	1.225E-4	1645	0.101	0.128	Q9U263.pdb.gz	SET26_CAEEL Histone-lysine N-methyltransferase set-26 OS=Caenorhabditis elegans OX=6239 GN=set-26 PE=1 SV=3
19	AFDB:Q9M658	0.041	0.043	2.720E-3	2001	0.096	0.100	Q9M658.pdb.gz	MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana OX=3702 GN=MOM1 PE=1 SV=1
20	AFDB:Q8I3S3	0.035	0.038	3.671E-3	1894	0.085	0.095	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2KTE1	0.0	2922	2100	0.716	0.716	B2KTE1_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
2	B2KTE2	0.0	2925	2084	0.716	0.721	B2KTE2_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
3	B2KTE3	0.0	2927	2091	0.716	0.719	B2KTE3_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
4	B2KTE4	0.0	2929	2075	0.717	0.725	B2KTE4_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
5	Q9Y2I7	0.0	4378	2098	1.000	1.000	FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3
6	Q9Z1T6	0.0	4031	2097	0.935	0.936	FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus OX=10090 GN=Pikfyve PE=1 SV=3
7	O96838	1.42e-147	506	1809	0.180	0.208	FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=fab1 PE=1 SV=2
8	G5ED98	1.39e-88	322	1497	0.073	0.102	G5ED98_CAEEL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Caenorhabditis elegans OX=6239 GN=ppk-3 PE=1 SV=1
9	P34756	1.47e-75	283	2278	0.084	0.077	FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAB1 PE=1 SV=3
10	Q6FM73	3.80e-74	278	2104	0.079	0.078	Q6FM73_CANGA 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K10384g PE=4 SV=1
11	B0G126	1.10e-72	273	2656	0.067	0.053	FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum OX=44689 GN=pip5k3 PE=3 SV=1
12	Q0WUR5	8.59e-72	270	1757	0.065	0.077	FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana OX=3702 GN=FAB1A PE=1 SV=1
13	O59722	6.30e-71	267	1932	0.068	0.073	FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fab1 PE=1 SV=2
14	Q9SSJ8	7.83e-71	266	1648	0.062	0.079	FAB1C_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C OS=Arabidopsis thaliana OX=3702 GN=FAB1C PE=2 SV=1
15	Q9LUM0	3.16e-70	265	1791	0.061	0.071	FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana OX=3702 GN=FAB1B PE=2 SV=1
16	A0A1D8PGH4	4.96e-69	261	2624	0.061	0.049	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
17	P39077	8.17e-25	113	534	0.039	0.152	TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT3 PE=1 SV=2
18	Q8JHI7	5.11e-24	111	543	0.039	0.149	Q8JHI7_DANRE T-complex protein 1 subunit gamma OS=Danio rerio OX=7955 GN=wu:fj48b06 PE=1 SV=1
19	Q54TH8	8.83e-24	110	530	0.037	0.147	TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum OX=44689 GN=cct3 PE=1 SV=1
20	O74341	3.86e-23	108	528	0.046	0.184	TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00118 Cpn60_TCP1	6.8e-32	122.4	TCP-1/cpn60 chaperonin family
2	PF00610 DEP	1.7e-15	68.1	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
3	PF01363 FYVE	3.3e-12	57.7	FYVE zinc finger
4	PF01504 PIP5K	8.2e-41	151.6	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230124	0.999	Polyphosphoinositide phosphatase
2	9606.ENSP00000261776	0.999	Protein VAC14 homolog
3	9606.ENSP00000262039	0.991	Phosphatidylinositol 3-kinase catalytic subunit type 3
4	9606.ENSP00000373713	0.984	Phosphatidylinositide phosphatase SAC1
5	9606.ENSP00000349205	0.981	Phosphoinositide 3-kinase regulatory subunit 4
6	9606.ENSP00000255882	0.979	Phosphatidylinositol 4-kinase alpha
7	9606.ENSP00000357869	0.976	Phosphatidylinositol 4-kinase beta
8	9606.ENSP00000345752	0.971	Myotubularin-related protein 2
9	9606.ENSP00000359423	0.971	Myotubularin
10	9606.ENSP00000359417	0.955	Myotubularin-related protein 1
11	9606.ENSP00000371221	0.954	Myotubularin-related protein 6
12	9606.ENSP00000264864	0.953	Phosphatidylinositol 4-kinase type 2-beta
13	9606.ENSP00000265970	0.953	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
14	9606.ENSP00000296003	0.951	Myotubularin-related protein 14
15	9606.ENSP00000359665	0.950	Phosphatidylinositol 4-kinase type 2-alpha
16	9606.ENSP00000361021	0.950	Phosphatase and tensin homolog
17	9606.ENSP00000074304	0.947	Type I inositol 3,4-bisphosphate 4-phosphatase
18	9606.ENSP00000219789	0.945	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
19	9606.ENSP00000356155	0.939	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
20	9606.ENSP00000352121	0.938	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0052742	1.000	phosphatidylinositol kinase activity
GO:0016308	1.000	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0000285	0.996	1-phosphatidylinositol-3-phosphate 5-kinase activity
GO:0042578	0.995	phosphoric ester hydrolase activity
GO:0052866	0.994	phosphatidylinositol phosphate phosphatase activity
GO:0034593	0.969	phosphatidylinositol bisphosphate phosphatase activity
GO:0106018	0.931	phosphatidylinositol-3,5-bisphosphate phosphatase activity
GO:0034595	0.930	phosphatidylinositol phosphate 5-phosphatase activity
GO:0052810	0.918	1-phosphatidylinositol-5-kinase activity
GO:0043813	0.597	phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0016192	0.987	vesicle-mediated transport
GO:0050794	0.980	regulation of cellular process
GO:0019637	0.976	organophosphate metabolic process
GO:0051641	0.974	cellular localization
GO:0044238	0.971	primary metabolic process
GO:0016050	0.970	vesicle organization
GO:0046486	0.963	glycerolipid metabolic process
GO:0006796	0.958	phosphate-containing compound metabolic process
GO:0046488	0.952	phosphatidylinositol metabolic process
GO:0050896	0.947	response to stimulus
GO:0090382	0.937	phagosome maturation
GO:0007033	0.934	vacuole organization
GO:0051716	0.932	cellular response to stimulus
GO:0031323	0.932	regulation of cellular metabolic process
GO:0061024	0.925	membrane organization
GO:0061025	0.917	membrane fusion
GO:0046907	0.904	intracellular transport
GO:0048284	0.897	organelle fusion
GO:0033059	0.876	cellular pigmentation
GO:0048753	0.868	pigment granule organization
GO:0006906	0.866	vesicle fusion
GO:0080171	0.807	lytic vacuole organization
GO:0045017	0.765	glycerolipid biosynthetic process
GO:0008654	0.765	phospholipid biosynthetic process
GO:0046474	0.760	glycerophospholipid biosynthetic process
GO:0051128	0.731	regulation of cellular component organization
GO:0007040	0.722	lysosome organization
GO:0032438	0.676	melanosome organization
GO:0033036	0.560	macromolecule localization
GO:0006661	0.523	phosphatidylinositol biosynthetic process
GO:0008104	0.518	protein localization
GO:0022607	0.490	cellular component assembly
GO:0007154	0.482	cell communication
GO:0009889	0.443	regulation of biosynthetic process
GO:0070887	0.439	cellular response to chemical stimulus
GO:0009605	0.436	response to external stimulus
GO:0006909	0.431	phagocytosis
GO:0002376	0.408	immune system process
GO:0070925	0.397	organelle assembly
GO:0033043	0.364	regulation of organelle organization
GO:1903426	0.349	regulation of reactive oxygen species biosynthetic process
GO:0030593	0.348	neutrophil chemotaxis
GO:0044087	0.341	regulation of cellular component biogenesis
GO:0016482	0.309	cytosolic transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005829	0.948	cytosol
GO:0098588	0.948	bounding membrane of organelle
GO:0012506	0.942	vesicle membrane
GO:0030659	0.932	cytoplasmic vesicle membrane
GO:0005794	0.926	Golgi apparatus
GO:0005768	0.901	endosome
GO:0010008	0.857	endosome membrane
GO:0048471	0.759	perinuclear region of cytoplasm
GO:0005769	0.678	early endosome
GO:0000139	0.667	Golgi membrane
GO:0005770	0.665	late endosome
GO:0031901	0.662	early endosome membrane
GO:0031902	0.541	late endosome membrane
GO:0071944	0.315	cell periphery
GO:0005773	0.309	vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	1.000	1-phosphatidylinositol-4-phosphate 5-kinase.
RHEA:13609	0.996	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + ADP + H(+)
EC:2.7.1.150	0.996	1-phosphatidylinositol-3-phosphate 5-kinase.
EC:3.1.-.-	0.995	Acting on ester bonds.
EC:3.1.3.-	0.994	Phosphoric monoester hydrolases.
RHEA:44680	0.918	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-5-phosphate) + ADP + H(+)

[back to server]