StarFunc result for job id Q9Y2J2

User Input

>input (1087 residues)
MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP
GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL
DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL
ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE
LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV
PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS
VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MRA8	0.362	0.424	0.000	918	0.812	0.962	A0A0A0MRA8.pdb.gz	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
2	AFDB:Q9JMB3	0.408	0.402	0.000	1105	0.860	0.846	Q9JMB3.pdb.gz
3	AFDB:Q9Y2J2	1.000	1.000	0.000	1087	1.000	1.000	Q9Y2J2.pdb.gz	E41L3_HUMAN Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2
4	AFDB:A0A0A0MSA4	0.176	0.182	1.522E-67	1046	0.638	0.663	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
5	AFDB:A0A2U3TZH6	0.319	0.408	1.273E-60	841	0.386	0.499	A0A2U3TZH6.pdb.gz	A0A2U3TZH6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
6	AFDB:A0A0G2KAK2	0.317	0.528	5.040E-52	638	0.322	0.549	A0A0G2KAK2.pdb.gz	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
7	AFDB:A0A3B3IU06	0.324	0.430	5.477E-51	807	0.300	0.404	A0A3B3IU06.pdb.gz	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
8	AFDB:A0T1Z4	0.292	0.340	2.684E-37	932	0.194	0.226	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
9	AFDB:Q9VFU8	0.303	0.337	4.459E-37	972	0.194	0.217	Q9VFU8.pdb.gz	Q9VFU8_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
10	AFDB:Q8BGS1	0.294	0.431	8.591E-34	731	0.178	0.265	Q8BGS1.pdb.gz	E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1
11	PDB:4rm8A	0.245	0.701	9.719E-22	368	0.087	0.258	4rm8A.pdb.gz
12	PDB:6r9tA	0.132	0.070	6.795E-8	2185	0.030	0.015	6r9tA.pdb.gz
13	PDB:7c3mA	0.200	0.362	4.676E-7	577	0.043	0.081	7c3mA.pdb.gz
14	PDB:5swpA	0.067	0.069	4.426E-4	1060	0.023	0.024	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
15	PDB:6mdhA	0.066	0.453	1.497E-3	149	0.013	0.094	6mdhA.pdb.gz
16	PDB:5itdA	0.067	0.073	2.135E-3	995	0.015	0.016	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
17	PDB:2y3aA	0.074	0.082	2.363E-3	976	0.024	0.027	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
18	PDB:3dbhI	0.065	0.666	2.616E-3	86	0.013	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
19	PDB:5dxhD	0.069	0.077	3.046E-3	981	0.031	0.035	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
20	PDB:7lq1A	0.071	0.081	3.046E-3	950	0.034	0.039	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRA8	1061	918	0.464	0.549	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
2	A0A0A0MSA4	597	1046	0.280	0.291	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
3	A0A0C4DH22	642	880	0.285	0.352	A0A0C4DH22_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=1
4	A0A0G2K161	556	764	0.244	0.347	A0A0G2K161_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
5	A0A0G2K1Q9	573	943	0.312	0.359	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
6	A0A0G2KAK2	555	637	0.244	0.416	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
7	A0A0J9YY18	563	325	0.267	0.892	A0A0J9YY18_HUMAN Erythrocyte membrane protein band 4.1 like 3 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
8	A0A1B0GTW6	645	1595	0.285	0.194	A0A1B0GTW6_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2
9	A0A2R8Y570	562	766	0.249	0.354	A0A2R8Y570_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
10	A0A2R8Y5B3	606	824	0.258	0.340	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
11	A0A2R8Y5G2	562	782	0.249	0.347	A0A2R8Y5G2_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
12	A0A2R8Y5Z6	561	787	0.249	0.344	A0A2R8Y5Z6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
13	A0A2R8Y6G5	562	680	0.249	0.399	A0A2R8Y6G5_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
14	A0A2R8Y7Y3	554	601	0.235	0.424	A0A2R8Y7Y3_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
15	A0A2R8YD30	555	655	0.235	0.389	A0A2R8YD30_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
16	A0A2R8YFR9	562	675	0.249	0.401	A0A2R8YFR9_HUMAN Protein 4.1 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
17	A0A2U3TZH6	566	841	0.249	0.322	A0A2U3TZH6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
18	A0A3B3IU06	562	807	0.249	0.336	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
19	A0A8I5Y1G9	924	933	0.430	0.501	A0A8I5Y1G9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
20	A0A8I5Y1T6	560	975	0.244	0.272	A0A8I5Y1T6_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05902 4_1_CTD	2e-50	180.6	4.1 protein C-terminal domain (CTD)
2	PF08736 FA	5e-15	66.5	FERM adjacent (FA)
3	PF09380 FERM_C	2e-20	84.3	FERM C-terminal PH-like domain
4	PF00373 FERM_M	3.4e-17	74.3	FERM central domain
5	PF09379 FERM_N	1.7e-21	87.2	FERM N-terminal domain
6	PF05132 RNA_pol_Rpc4	2.2e+02	13.6	RNA polymerase III RPC4
7	PF04382 SAB	1.1e-18	78.3	SAB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329797	0.998	Cell adhesion molecule 1
2	9606.ENSP00000264638	0.991	Contactin-associated protein 1
3	9606.ENSP00000354778	0.989	Contactin-associated protein-like 2
4	9606.ENSP00000349259	0.925	Spectrin beta chain, non-erythrocytic 1
5	9606.ENSP00000349588	0.876	Ankyrin-2
6	9606.ENSP00000361824	0.872	Spectrin alpha chain, non-erythrocytic 1
7	9606.ENSP00000259254	0.822	Glycophorin-C
8	9606.ENSP00000331879	0.788	Protein arginine N-methyltransferase 3
9	9606.ENSP00000330633	0.753	Contactin-2
10	9606.ENSP00000367408	0.751	Peripheral plasma membrane protein CASK
11	9606.ENSP00000392500	0.740	Neuroligin-1
12	9606.ENSP00000265709	0.709	Ankyrin-1
13	9606.ENSP00000364945	0.708	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
14	9606.ENSP00000265459	0.705	Neurexin-2
15	9606.ENSP00000344786	0.705	Neurofascin
16	9606.ENSP00000385142	0.699	Neurexin-1
17	9606.ENSP00000319169	0.696	Protein arginine N-methyltransferase 5
18	9606.ENSP00000451648	0.696	Neurexin-3
19	9606.ENSP00000361930	0.693	14-3-3 protein beta/alpha
20	9606.ENSP00000306330	0.689	14-3-3 protein gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043495	0.998	protein-membrane adaptor activity
GO:0005200	0.997	structural constituent of cytoskeleton
GO:0008093	0.997	cytoskeletal anchor activity
GO:0106006	0.784	cytoskeletal protein-membrane anchor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.991	cellular component organization
GO:0006996	0.847	organelle organization
GO:0065007	0.637	biological regulation
GO:0007010	0.560	cytoskeleton organization
GO:0030865	0.537	cortical cytoskeleton organization
GO:0050789	0.536	regulation of biological process
GO:0050794	0.488	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.990	cell junction
GO:0005737	0.966	cytoplasm
GO:0005829	0.936	cytosol
GO:0043226	0.760	organelle
GO:0120025	0.465	plasma membrane bounded cell projection
GO:0043005	0.410	neuron projection
GO:0070161	0.363	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]