StarFunc result for job id Q9Y2J8

User Input

>input (665 residues)
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4n20A	0.933	0.970	0.000	639	0.956	0.995	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
2	PDB:4n2iA	0.973	0.977	0.000	662	0.988	0.992	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
3	AFDB:Q08642	0.998	0.986	0.000	673	0.932	0.921	Q08642.pdb.gz	PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus OX=10090 GN=Padi2 PE=1 SV=2
4	AFDB:F1NP39	0.953	0.943	9.188E-103	672	0.565	0.560	F1NP39.pdb.gz	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
5	AFDB:E1C0W6	0.947	0.953	4.174E-100	661	0.531	0.534	E1C0W6.pdb.gz	E1C0W6_CHICK protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD1 PE=2 SV=1
6	AFDB:Q9UM07	0.945	0.948	5.846E-100	663	0.504	0.505	Q9UM07.pdb.gz	PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens OX=9606 GN=PADI4 PE=1 SV=2
7	AFDB:Q9ULW8	0.949	0.950	6.183E-100	664	0.519	0.520	Q9ULW8.pdb.gz	PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens OX=9606 GN=PADI3 PE=1 SV=2
8	AFDB:P70708	0.945	0.946	1.024E-98	664	0.511	0.512	P70708.pdb.gz	PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus OX=10116 GN=Padi3 PE=2 SV=1
9	AFDB:Q9Z183	0.932	0.930	3.715E-96	666	0.504	0.503	Q9Z183.pdb.gz	PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus OX=10090 GN=Padi4 PE=1 SV=3
10	AFDB:O88807	0.930	0.929	6.889E-96	666	0.507	0.506	O88807.pdb.gz	PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus OX=10116 GN=Padi4 PE=2 SV=1
11	AFDB:Q9ULC6	0.940	0.943	4.909E-94	663	0.523	0.525	Q9ULC6.pdb.gz	PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens OX=9606 GN=PADI1 PE=1 SV=2
12	AFDB:O88806	0.940	0.944	4.636E-93	662	0.514	0.517	O88806.pdb.gz	PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus OX=10116 GN=Padi1 PE=1 SV=1
13	PDB:5n0zA	0.899	0.936	6.915E-93	638	0.499	0.520	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
14	PDB:5hp5A	0.925	0.919	6.149E-88	669	0.525	0.522	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
15	PDB:7d56C	0.875	0.908	3.699E-85	640	0.501	0.520	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
16	PDB:4x8gA	0.861	0.941	1.993E-84	606	0.483	0.530	4x8gA.pdb.gz	Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.
17	PDB:7d4yB	0.819	0.901	1.677E-80	601	0.474	0.524	7d4yB.pdb.gz
18	PDB:3apnA	0.781	0.916	2.616E-76	563	0.459	0.542	3apnA.pdb.gz
19	PDB:3h7cX	0.321	0.527	1.946E-7	369	0.092	0.165	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
20	PDB:1kiuB	0.114	0.208	2.877E-5	279	0.044	0.104	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C0W6	0.0	704	661	0.531	0.534	E1C0W6_CHICK protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD1 PE=2 SV=1
2	F1NP39	0.0	756	672	0.570	0.564	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
3	G1T837	0.0	1296	665	0.934	0.934	G1T837_RABIT Protein-arginine deiminase OS=Oryctolagus cuniculus OX=9986 GN=PADI2 PE=3 SV=2
4	O57400	0.0	760	672	0.571	0.565	O57400_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 PE=2 SV=1
5	O88806	0.0	649	662	0.514	0.517	PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus OX=10116 GN=Padi1 PE=1 SV=1
6	O88807	0.0	659	666	0.510	0.509	PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus OX=10116 GN=Padi4 PE=2 SV=1
7	P20717	0.0	1302	665	0.937	0.937	PADI2_RAT Protein-arginine deiminase type-2 OS=Rattus norvegicus OX=10116 GN=Padi2 PE=1 SV=1
8	P70708	0.0	674	664	0.508	0.509	PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus OX=10116 GN=Padi3 PE=2 SV=1
9	Q08642	0.0	1301	673	0.932	0.921	PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus OX=10090 GN=Padi2 PE=1 SV=2
10	Q6PFK7	0.0	669	647	0.528	0.543	Q6PFK7_DANRE protein-arginine deiminase OS=Danio rerio OX=7955 GN=zgc:66317 PE=1 SV=1
11	Q6TGC4	0.0	550	694	0.457	0.438	PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens OX=9606 GN=PADI6 PE=1 SV=3
12	Q9ULC6	0.0	676	663	0.526	0.528	PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens OX=9606 GN=PADI1 PE=1 SV=2
13	Q9ULW8	0.0	698	664	0.519	0.520	PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens OX=9606 GN=PADI3 PE=1 SV=2
14	Q9UM07	0.0	665	663	0.507	0.508	PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens OX=9606 GN=PADI4 PE=1 SV=2
15	Q9Y2J8	0.0	1377	665	1.000	1.000	PADI2_HUMAN Protein-arginine deiminase type-2 OS=Homo sapiens OX=9606 GN=PADI2 PE=1 SV=2
16	Q9Z183	0.0	662	666	0.508	0.508	PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus OX=10090 GN=Padi4 PE=1 SV=3
17	Q9Z184	0.0	674	664	0.508	0.509	PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus OX=10090 GN=Padi3 PE=1 SV=2
18	Q9Z185	0.0	649	662	0.511	0.514	PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus OX=10090 GN=Padi1 PE=1 SV=1
19	Q8K3V4	1.28e-155	466	682	0.411	0.400	PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus OX=10090 GN=Padi6 PE=1 SV=2
20	Q53HY9	1.01e-06	49.7	105	0.050	0.314	Q53HY9_HUMAN PADI4 protein (Fragment) OS=Homo sapiens OX=9606 GN=PADI4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03068 PAD	8.1e-166	563.5	Protein-arginine deiminase (PAD)
2	PF08527 PAD_M	6e-64	226.0	Protein-arginine deiminase (PAD) middle domain
3	PF08526 PAD_N	2.2e-30	116.7	Protein-arginine deiminase (PAD) N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364635

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.766	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000483825	0.745	NF-kappa-B essential modulator
3	9606.ENSP00000389009	0.717	Carnosine synthase 1
4	9606.ENSP00000305107	0.716	GTPase IMAP family member 8
5	9606.ENSP00000234347	0.671	Myeloblastin
6	9606.ENSP00000296511	0.656	Annexin A5
7	9606.ENSP00000380958	0.630	Myelin basic protein
8	9606.ENSP00000369325	0.627	Cyclin-dependent kinase-like 5
9	9606.ENSP00000415579	0.623	Transcriptional repressor CTCFL
10	9606.ENSP00000480484	0.607	Trichohyalin
11	9606.ENSP00000357789	0.602	Filaggrin
12	9606.ENSP00000366654	0.576	Carbonic anhydrase 6
13	9606.ENSP00000234590	0.556	Alpha-enolase
14	9606.ENSP00000346389	0.541	Myocyte-specific enhancer factor 2A
15	9606.ENSP00000357753	0.538	Involucrin
16	9606.ENSP00000354511	0.512	Catechol O-methyltransferase
17	9606.ENSP00000299698	0.510	Alpha-2-macroglobulin-like protein 1
18	9606.ENSP00000476960	0.503	Histone cluster 2 H3 pseudogene 2
19	9606.ENSP00000409906	0.501	Inactive ubiquitin carboxyl-terminal hydrolase 53
20	9606.ENSP00000435582	0.501	Cytosolic carboxypeptidase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004668	1.000	protein-arginine deiminase activity
GO:0005488	0.994	binding
GO:0005515	0.977	protein binding
GO:0042802	0.311	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.931	response to stimulus
GO:0048519	0.918	negative regulation of biological process
GO:0051716	0.836	cellular response to stimulus
GO:0048583	0.821	regulation of response to stimulus
GO:0071840	0.819	cellular component organization or biogenesis
GO:0048523	0.818	negative regulation of cellular process
GO:0010646	0.802	regulation of cell communication
GO:0023051	0.775	regulation of signaling
GO:0042221	0.698	response to chemical
GO:0010033	0.636	response to organic substance
GO:0016043	0.635	cellular component organization
GO:0048518	0.564	positive regulation of biological process
GO:0032502	0.539	developmental process
GO:0048585	0.499	negative regulation of response to stimulus
GO:0071310	0.444	cellular response to organic substance
GO:0009966	0.444	regulation of signal transduction
GO:0019222	0.440	regulation of metabolic process
GO:0060255	0.406	regulation of macromolecule metabolic process
GO:0009968	0.392	negative regulation of signal transduction
GO:0048856	0.373	anatomical structure development
GO:0032501	0.368	multicellular organismal process
GO:0008152	0.366	metabolic process
GO:0071704	0.347	organic substance metabolic process
GO:0010468	0.326	regulation of gene expression
GO:0006807	0.321	nitrogen compound metabolic process
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.998	intracellular organelle lumen
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.838	endomembrane system
GO:0031982	0.764	vesicle
GO:0005634	0.752	nucleus
GO:0031981	0.635	nuclear lumen
GO:0031410	0.504	cytoplasmic vesicle
GO:0005576	0.451	extracellular region
GO:0005654	0.417	nucleoplasm
GO:0043232	0.405	intracellular non-membrane-bounded organelle
GO:0005773	0.383	vacuole
GO:0000323	0.374	lytic vacuole
GO:1903561	0.367	extracellular vesicle
GO:0005764	0.356	lysosome
GO:0099503	0.319	secretory vesicle
GO:0030141	0.300	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18089	1.000	H2O + L-arginyl-[protein] = L-citrullyl-[protein] + NH4(+)
EC:3.5.3.15	1.000	protein-arginine deiminase.

[back to server]