StarFunc result for job id Q9Y2K1

User Input

>input (713 residues)
MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHST
AQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDAD
CSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREADEESL
QLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDSCGFGFSCEKLLDEHVLTCTN
RHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTG
SRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDKDCNESTDNDE
LEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDAEN
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNG
LGNTEEKMDLEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCG
QRFETENLVVEHMSSCLDQDMFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVH
TKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91VL9	0.333	0.333	2.840E-100	713	0.950	0.950	Q91VL9.pdb.gz	ZBTB1_MOUSE Zinc finger and BTB domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zbtb1 PE=1 SV=1
2	AFDB:P47043	0.124	0.104	7.359E-11	880	0.135	0.109	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
3	AFDB:Q8NAP3	0.113	0.070	1.700E-9	1195	0.154	0.092	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
4	AFDB:P41696	0.118	0.094	3.726E-9	914	0.151	0.118	P41696.pdb.gz	AZF1_YEAST Transcription factor AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AZF1 PE=1 SV=1
5	AFDB:Q5BIH1	0.121	0.109	1.040E-8	803	0.133	0.118	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:Q9C0K0	0.096	0.079	6.702E-7	894	0.122	0.097	Q9C0K0.pdb.gz	BC11B_HUMAN B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B PE=1 SV=1
7	AFDB:Q96T25	0.128	0.136	9.064E-7	663	0.125	0.134	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
8	AFDB:Q9W2F0	0.082	0.072	2.242E-6	835	0.154	0.132	Q9W2F0.pdb.gz	Q9W2F0_DROME LD45439p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10321 PE=2 SV=1
9	AFDB:Q8N1G0	0.064	0.043	2.530E-6	1237	0.150	0.086	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
10	AFDB:P11161	0.086	0.124	4.627E-6	476	0.104	0.155	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
11	PDB:3w5kB	0.077	0.278	3.370E-4	110	0.041	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4z4kA	0.057	0.128	8.199E-2	282	0.017	0.043	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
13	PDB:7dvqM	0.034	0.103	5.660E-1	191	0.028	0.105	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:4wa6D	0.047	0.065	6.387E-1	415	0.022	0.039	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	PDB:6ydhA	0.039	0.209	6.784E-1	62	0.020	0.226	6ydhA.pdb.gz
16	PDB:4c2mI	0.035	0.109	8.131E-1	124	0.025	0.145	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
17	PDB:4fjcE	0.046	0.063	8.638E-1	434	0.024	0.039	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
18	PDB:1b8tA	0.039	0.099	1.168	192	0.043	0.161	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
19	PDB:5dkaA	0.045	0.194	1.318	96	0.022	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:6ff4t	0.034	0.112	1.487	172	0.034	0.140	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91VL9	0.0	1369	713	0.951	0.951	ZBTB1_MOUSE Zinc finger and BTB domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zbtb1 PE=1 SV=1
2	Q9Y2K1	0.0	1494	713	1.000	1.000	ZBTB1_HUMAN Zinc finger and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBTB1 PE=1 SV=3
3	G3V447	4.15e-108	327	155	0.217	1.000	G3V447_HUMAN Zinc finger and BTB domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB1 PE=1 SV=1
4	G3V2I8	2.10e-88	274	130	0.182	1.000	G3V2I8_HUMAN Zinc finger and BTB domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB1 PE=1 SV=1
5	Q13105	5.65e-21	100	803	0.062	0.055	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
6	P41183	1.43e-20	99.0	707	0.226	0.228	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
7	Q60821	4.29e-20	97.8	794	0.062	0.055	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
8	Q9UFB7	8.87e-20	96.7	747	0.081	0.078	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
9	Q99592	2.43e-19	94.4	522	0.060	0.082	ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZBTB18 PE=1 SV=1
10	Q9WUK6	2.57e-19	94.4	522	0.060	0.082	ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus OX=10090 GN=Zbtb18 PE=1 SV=1
11	P24278	5.23e-19	92.4	435	0.062	0.101	ZBT25_HUMAN Zinc finger and BTB domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZBTB25 PE=1 SV=2
12	Q6NSZ9	5.25e-19	93.6	544	0.084	0.110	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
13	Q9Y2D9	8.06e-19	93.2	606	0.065	0.076	ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3
14	M9PBS1	1.28e-18	92.4	603	0.079	0.093	M9PBS1_DROME Earmuff, isoform B OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
15	Q9VQ56	1.37e-18	92.4	611	0.079	0.092	ERM_DROME Fez family zinc finger protein erm OS=Drosophila melanogaster OX=7227 GN=erm PE=1 SV=2
16	M9PB02	1.53e-18	92.4	654	0.079	0.086	M9PB02_DROME Earmuff, isoform C OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
17	A0A0R4YI50	1.62e-18	92.4	698	0.079	0.080	A0A0R4YI50_DROME Earmuff, isoform D OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
18	Q8N680	2.50e-18	91.3	514	0.070	0.097	ZBTB2_HUMAN Zinc finger and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBTB2 PE=1 SV=1
19	P51814	3.67e-18	91.7	821	0.093	0.080	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
20	Q96PE6	3.97e-18	90.1	472	0.108	0.163	ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens OX=9606 GN=ZIM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	3e-16	71.0	BTB/POZ domain
2	PF14353 CpXC	72	14.9	CpXC protein
3	PF00096 zf-C2H2	2.3e-05	35.7	Zinc finger, C2H2 type
4	PF18868 zf-C2H2_3rep	2.2e+02	13.9	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	1.1e-06	40.0	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	62	15.3	Zinc-finger double-stranded RNA-binding
7	PF05605 zf-Di19	4.3e+02	12.6	Drought induced 19 protein (Di19), zinc-binding
8	PF13465 zf-H2C2_2	0.0062	28.1	Zinc-finger double domain
9	PF12874 zf-met	2.2e+02	13.7	Zinc-finger of C2H2 type
10	PF18439 zf_UBZ	28	15.8	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293845	0.717	Coiled-coil domain-containing protein 42
2	9606.ENSP00000235835	0.689	Aflatoxin B1 aldehyde reductase member 2
3	9606.ENSP00000307746	0.649	Zinc finger protein 608
4	9606.ENSP00000405965	0.615	Small ubiquitin-related modifier 2
5	9606.ENSP00000242784	0.600	Telomerase RNA component interacting RNase
6	9606.ENSP00000278823	0.582	Metastasis-associated protein MTA2
7	9606.ENSP00000261721	0.567	BTB/POZ domain-containing protein 1
8	9606.ENSP00000265807	0.561	SH2 domain-containing protein 4A
9	9606.ENSP00000371614	0.534	Serine/threonine-protein kinase BRSK2
10	9606.ENSP00000340297	0.518	Rho guanine nucleotide exchange factor 10
11	9606.ENSP00000479910	0.516	Protein AF-17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0097159	0.598	organic cyclic compound binding
GO:1901363	0.596	heterocyclic compound binding
GO:0003676	0.511	nucleic acid binding
GO:0003677	0.388	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.961	regulation of biosynthetic process
GO:0051252	0.931	regulation of RNA metabolic process
GO:0031326	0.928	regulation of cellular biosynthetic process
GO:0010468	0.898	regulation of gene expression
GO:0071704	0.895	organic substance metabolic process
GO:0044238	0.889	primary metabolic process
GO:2001141	0.885	regulation of RNA biosynthetic process
GO:0006807	0.847	nitrogen compound metabolic process
GO:0048519	0.802	negative regulation of biological process
GO:0006355	0.702	regulation of DNA-templated transcription
GO:0043170	0.649	macromolecule metabolic process
GO:0044237	0.599	cellular metabolic process
GO:0048523	0.570	negative regulation of cellular process
GO:0048518	0.487	positive regulation of biological process
GO:0050896	0.459	response to stimulus
GO:0009892	0.381	negative regulation of metabolic process
GO:0045934	0.374	negative regulation of nucleobase-containing compound metabolic process
GO:0048522	0.328	positive regulation of cellular process
GO:0051716	0.323	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016020	0.982	membrane
GO:0043228	0.977	non-membrane-bounded organelle
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0012505	0.633	endomembrane system
GO:0005737	0.524	cytoplasm
GO:0031975	0.313	envelope
GO:0005829	0.313	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]