StarFunc result for job id Q9Y2K2

User Input

>input (1321 residues)
MAAAAASGAGGAAGAGTGGAGPAGRLLPPPAPGSPAAPAAVSPAAGQPRPPAPASRGPMP
ARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKML
CHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCH
CRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYD
GPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVL
DPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKEERQVDPLNEDVLLAMEDMGLDK
EQTLQSLRSDAYDHYSAIYSLLCDRHKRHKTLRLGALPSMPRALAFQAPVNIQAEQAGTA
MNISVPQVQLINPENQIVEPDGTLNLDSDEGEEPSPEALVRYLSMRRHTVGVADPRTEVM
EDLQKLLPGFPGVNPQAPFLQVAPNVNFMHNLLPMQNLQPTGQLEYKEQSLLQPPTLQLL
NGMGPLGRRASDGGANIQLHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEA
VQSSTYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQK
MYGGQIDERTLEKTQQQHMLYQQEQHHQILQQQIQDSICPPQPSPPLQAACENQPALLTH
QLQRLRIQPSSPPPNHPNNHLFRQPSNSPPPMSSAMIQPHGAASSSQFQGLPSRSAIFQQ
QPENCSSPPNVALTCLGMQQPAQSQQVTIQVQEPVDMLSNMPGTAAGSSGRGISISPSAG
QMQMQHRTNLMATLSYGHRPLSKQLSADSAEAHSLNVNRFSPANYDQAHLHPHLFSDQSR
GSPSSYSPSTGVGFSPTQALKVPPLDQFPTFPPSAHQQPPHYTTSALQQALLSPTPPDYT
RHQQVPHILQGLLSPRHSLTGHSDIRLPPTEFAQLIKRQQQQRQQQQQQQQQQEYQELFR
HMNQGDAGSLAPSLGGQSMTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPP
HGYAHQPALMHSESMEEDCSCEGAKDGFQDSKSSSTLTKGCHDSPLLLSTGGPGDPESLL
GTVSHAQELGIHPYGHQPTAAFSKNKVPSREPVIGNCMDRSSPGQAVELPDHNGLGYPAR
PSVHEHHRPRALQRHHTIQNSDDAYVQLDNLPGMSLVAGKALSSARMSDAVLSQSSLMGS
QQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPSTCITDILLSYKHPEVSFSMEQAG
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2K2	0.999	0.999	0.000	1321	1.000	1.000	Q9Y2K2.pdb.gz	SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=4
2	AFDB:Q8CFH6	0.253	0.356	1.030E-48	931	0.244	0.346	Q8CFH6.pdb.gz	SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1
3	AFDB:Q9TW45	0.245	0.270	1.044E-44	1192	0.217	0.240	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
4	AFDB:Q21017	0.262	0.415	1.112E-42	822	0.157	0.252	Q21017.pdb.gz	KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans OX=6239 GN=kin-29 PE=1 SV=2
5	AFDB:Q00372	0.202	0.429	2.943E-37	612	0.120	0.258	Q00372.pdb.gz	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
6	AFDB:A0A1D8PN61	0.208	0.436	1.073E-36	618	0.121	0.259	A0A1D8PN61.pdb.gz	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
7	AFDB:Q8IY84	0.226	0.669	1.427E-35	436	0.104	0.314	Q8IY84.pdb.gz	NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens OX=9606 GN=NIM1K PE=1 SV=1
8	AFDB:Q19469	0.211	0.302	4.153E-35	914	0.158	0.229	Q19469.pdb.gz	SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans OX=6239 GN=sad-1 PE=1 SV=2
9	AFDB:P34244	0.209	0.183	4.916E-35	1518	0.196	0.171	P34244.pdb.gz	HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL1 PE=1 SV=2
10	AFDB:H2KYA5	0.199	0.148	1.143E-34	1793	0.209	0.154	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
11	PDB:7myjC	0.201	0.551	3.172E-34	465	0.108	0.308	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:6b1uA	0.202	0.586	1.532E-33	442	0.105	0.314	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:4zhxA	0.198	0.622	1.227E-32	409	0.103	0.333	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:4rerA	0.203	0.569	2.286E-31	459	0.108	0.312	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4rewA	0.199	0.615	6.293E-31	411	0.098	0.314	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:5ufuA	0.193	0.679	1.236E-30	369	0.094	0.336	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:5u6yA	0.186	0.522	3.070E-27	459	0.077	0.222	5u6yA.pdb.gz
18	PDB:4cztD	0.179	0.732	1.569E-26	302	0.089	0.387	4cztD.pdb.gz
19	PDB:4d28C	0.179	0.802	4.567E-26	279	0.089	0.419	4d28C.pdb.gz
20	PDB:6byrA	0.195	0.619	1.069E-23	405	0.067	0.217	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y4E8	0.0	2688	1369	0.999	0.964	H0Y4E8_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=2
2	Q6P4S6	0.0	2200	1369	0.880	0.849	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
3	Q9Y2K2	0.0	2714	1321	1.000	1.000	SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=4
4	Q8CFH6	4.73e-146	469	931	0.168	0.238	SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1
5	Q9H0K1	1.46e-145	467	926	0.167	0.238	SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1
6	Q9IA88	2.92e-144	460	798	0.160	0.264	SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus OX=9031 GN=SIK2 PE=2 SV=1
7	Q9W532	8.01e-141	467	1398	0.165	0.156	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
8	Q60670	2.99e-138	443	779	0.150	0.254	SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus OX=10090 GN=Sik1 PE=1 SV=3
9	Q9R1U5	7.06e-137	439	776	0.149	0.254	SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus OX=10116 GN=Sik1 PE=1 SV=1
10	P57059	9.64e-135	434	783	0.148	0.249	SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens OX=9606 GN=SIK1 PE=1 SV=2
11	A0A0B4J2F2	1.29e-134	434	783	0.148	0.249	SIK1B_HUMAN Putative serine/threonine-protein kinase SIK1B OS=Homo sapiens OX=9606 GN=SIK1B PE=5 SV=1
12	A1ZBC4	1.36e-130	440	1471	0.188	0.169	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
13	Q963E6	2.33e-129	421	832	0.153	0.243	Q963E6_DROME Par-1, isoform W OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
14	E1JGM9	3.31e-129	421	827	0.153	0.244	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
15	Q6NPA6	4.34e-129	420	833	0.153	0.242	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
16	Q9V8V8	9.96e-127	417	938	0.153	0.215	Q9V8V8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
17	A1ZBL5	1.94e-126	417	951	0.153	0.212	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
18	A1ZBL7	3.20e-126	417	993	0.151	0.200	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
19	O08679	3.42e-126	409	722	0.142	0.259	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
20	Q7YU80	9.42e-126	417	1046	0.151	0.190	Q7YU80_DROME Par-1, isoform R OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7.6	17.1	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	44	14.5	Haspin like kinase domain
3	PF06293 Kdo	10	17.0	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	0.036	25.0	Kinase-like
5	PF00069 Pkinase	6.5e-72	253.7	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	1.6e-37	140.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364449

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357622	0.972	CREB-regulated transcription coactivator 2
2	9606.ENSP00000379287	0.971	14-3-3 protein zeta/delta
3	9606.ENSP00000264335	0.954	14-3-3 protein epsilon
4	9606.ENSP00000248975	0.948	14-3-3 protein eta
5	9606.ENSP00000258418	0.940	Calcium-binding protein 39
6	9606.ENSP00000340989	0.935	14-3-3 protein sigma
7	9606.ENSP00000361930	0.935	14-3-3 protein beta/alpha
8	9606.ENSP00000371267	0.935	14-3-3 protein theta
9	9606.ENSP00000324856	0.931	Serine/threonine-protein kinase STK11
10	9606.ENSP00000336655	0.920	STE20-related kinase adapter protein alpha
11	9606.ENSP00000306330	0.915	14-3-3 protein gamma
12	9606.ENSP00000194530	0.902	STE20-related kinase adapter protein beta
13	9606.ENSP00000251127	0.751	Sodium leak channel non-selective protein
14	9606.ENSP00000345001	0.702	CREB-regulated transcription coactivator 1
15	9606.ENSP00000268184	0.673	CREB-regulated transcription coactivator 3
16	9606.ENSP00000264606	0.642	Histone deacetylase 4
17	9606.ENSP00000216923	0.595	Zinc finger protein 64 homolog, isoforms 1 and 2
18	9606.ENSP00000254480	0.566	SWI/SNF complex subunit SMARCC1
19	9606.ENSP00000260210	0.557	BUD13 homolog
20	9606.ENSP00000236850	0.548	Apolipoprotein A-I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000287	1.000	magnesium ion binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0019899	0.345	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0071704	0.952	organic substance metabolic process
GO:0044238	0.952	primary metabolic process
GO:0048518	0.880	positive regulation of biological process
GO:0006807	0.862	nitrogen compound metabolic process
GO:0044237	0.862	cellular metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:0048522	0.857	positive regulation of cellular process
GO:0019538	0.854	protein metabolic process
GO:0036211	0.787	protein modification process
GO:0019222	0.717	regulation of metabolic process
GO:0006796	0.676	phosphate-containing compound metabolic process
GO:0050896	0.599	response to stimulus
GO:0031323	0.574	regulation of cellular metabolic process
GO:0032501	0.567	multicellular organismal process
GO:0060255	0.520	regulation of macromolecule metabolic process
GO:0080090	0.467	regulation of primary metabolic process
GO:0048856	0.431	anatomical structure development
GO:0051716	0.423	cellular response to stimulus
GO:0007165	0.401	signal transduction
GO:0048519	0.393	negative regulation of biological process
GO:0048523	0.347	negative regulation of cellular process
GO:0009966	0.347	regulation of signal transduction
GO:0051171	0.345	regulation of nitrogen compound metabolic process
GO:0006468	0.336	protein phosphorylation
GO:0009893	0.310	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.994	cytoplasm
GO:0005829	0.693	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]