StarFunc result for job id Q9Y2K3

User Input

>input (1946 residues)
MVESCLLTFRAFFWWIALIKMDLSDLGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGE
NAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFEMIEDMAMLTHLNEASVL
HTLKRRYGQWMIYTYSGLFCVTINPYKWLPVYQKEVMAAYKGKRRSEAPPHIFAVANNAF
QDMLHNRENQSILFTGESGAGKTVNSKHIIQYFATIAAMIESRKKQGALEDQIMQANTIL
EAFGNAKTLRNDNSSRFGKFIRMHFGARGMLSSVDIDIYLLEKSRVIFQQAGERNYHIFY
QILSGQKELHDLLLVSANPSDFHFCSCGAVTVESLDDAEELLATEQAMDILGFLPDEKYG
CYKLTGAIMHFGNMKFKQKPREEQLEADGTENADKAAFLMGINSSELVKCLIHPRIKVGN
EYVTRGQTIEQVTCAVGALSKSMYERMFKWLVARINRALDAKLSRQFFIGILDITGFEIL
EYNSLEQLCINFTNEKLQQFFNWHMFVLEQEEYKKESIEWVSIGFGLDLQACIDLIEKPM
GILSILEEECMFPKATDLTFKTKLFDNHFGKSVHLQKPKPDKKKFEAHFELVHYAGVVPY
NISGWLEKNKDLLNETVVAVFQKSSNRLLASLFENYMSTDSAIPFGEKKRKKGASFQTVA
SLHKENLNKLMTNLKSTAPHFVRCINPNVNKIPGILDPYLVLQQLRCNGVLEGTRICREG
FPNRLQYADFKQRYCILNPRTFPKSKFVSSRKAAEELLGSLEIDHTQYRFGITKVFFKAG
FLGQLEAIRDERLSKVFTLFQARAQGKLMRIKFQKILEERDALILIQWNIRAFMAVKNWP
WMRLFFKIKPLVKSSEVGEEVAGLKEECAQLQKALEKSEFQREELKAKQVSLTQEKNDLI
LQLQAEQETLANVEEQCEWLIKSKIQLEARVKELSERVEEEEEINSELTARGRKLEDECF
ELKKEIDDLETMLVKSEKEKRTTEHKVKNLTEEVEFLNEDISKLNRAAKVVQEAHQQTLD
DLHMEEEKLSSLSKANLKLEQQVDELEGALEQERKARMNCERELHKLEGNLKLNRESMEN
LESSQRHLAEELRKKELELSQMNSKVENEKGLVAQLQKTVKELQTQIKDLKEKLEAERTT
RAKMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETT
SASLKKRHADSLAELEGQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAKANAEKL
CTLYEERLHEATAKLDKVTQLANDLAAQKTKLWSESGEFLRRLEEKEALINQLSREKSNF
TRQIEDLRGQLEKETKSQSALAHALQKAQRDCDLLREQYEEEQEVKAELHRTLSKVNAEM
VQWRMKYENNVIQRTEDLEDAKKELAIRLQEAAEAMGVANARNASLERARHQLQLELGDA
LSDLGKVRSAAARLDQKQLQSGKALADWKQKHEESQALLDASQKEVQALSTELLKLKNTY
EESIVGQETLRRENKNLQEEISNLTNQVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETE
GALERNESKILHFQLELLEAKAELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSR
IEVTRLKKKMEEDLNEMELQLSCANRQVSEATKSLGQLQIQIKDLQMQLDDSTQLNSDLK
EQVAVAERRNSLLQSELEDLRSLQEQTERGRRLSEEELLEATERINLFYTQNTSLLSQKK
KLEADVARMQKEAEEVVQECQNAEEKAKKAAIEAANLSEELKKKQDTIAHLERTRENMEQ
TITDLQKRLAEAEQMALMGSRKQIQKLESRVRELEGELEGEIRRSAEAQRGARRLERCIK
ELTYQAEEDKKNLSRMQTQMDKLQLKVQNYKQQVEVAETQANQYLSKYKKQQHELNEVKE
RAEVAESQVNKLKIKAREFGKKVQEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JY53	0.623	0.633	0.000	1915	0.731	0.743	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	AFDB:A0A0N4STT5	0.663	0.645	0.000	2008	0.604	0.586	A0A0N4STT5.pdb.gz
3	AFDB:A7E2Y1	0.737	0.724	0.000	1983	0.601	0.590	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.631	0.633	0.000	1938	0.594	0.596	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B8A568	0.625	0.627	0.000	1937	0.583	0.585	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
6	AFDB:B8JLS3	0.664	0.667	0.000	1936	0.589	0.592	B8JLS3.pdb.gz
7	AFDB:E7FD18	0.634	0.634	0.000	1945	0.627	0.628	E7FD18.pdb.gz
8	AFDB:G3UW82	0.673	0.674	0.000	1942	0.593	0.594	G3UW82.pdb.gz	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
9	AFDB:P02566	0.627	0.622	0.000	1963	0.434	0.430	P02566.pdb.gz	MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans OX=6239 GN=unc-54 PE=1 SV=2
10	AFDB:P02567	0.606	0.608	0.000	1938	0.403	0.405	P02567.pdb.gz	MYO1_CAEEL Myosin-1 OS=Caenorhabditis elegans OX=6239 GN=myo-1 PE=1 SV=3
11	PDB:4pa0A	0.336	0.652	4.189E-94	974	0.260	0.518	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.336	0.692	3.950E-90	920	0.256	0.541	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.334	0.666	1.505E-85	952	0.250	0.511	4p7hB.pdb.gz
14	PDB:5tbyA	0.367	0.714	1.689E-83	954	0.324	0.660	5tbyA.pdb.gz
15	PDB:7mf3B	0.363	0.766	6.469E-63	896	0.214	0.464	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.343	0.656	1.186E-59	995	0.126	0.246	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.360	0.818	1.463E-52	817	0.115	0.273	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.042	0.098	1.260E-1	529	0.032	0.119	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:6bqrA	0.046	0.071	2.247E-1	948	0.048	0.098	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
20	PDB:1k9aB	0.023	0.093	6.802E-1	441	0.004	0.018	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2847	1922	0.746	0.755	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	2307	1912	0.591	0.601	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	2298	1937	0.582	0.585	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	2324	1939	0.591	0.594	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	2360	1938	0.606	0.608	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	684	1948	0.215	0.215	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2273	1941	0.605	0.606	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1090	1972	0.364	0.359	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2273	1983	0.608	0.597	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	2294	1938	0.596	0.599	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	2370	1939	0.606	0.608	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2291	1941	0.604	0.605	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	2266	1937	0.585	0.588	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	2328	1939	0.592	0.595	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	2301	1943	0.585	0.586	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	2372	1938	0.612	0.614	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1067	1992	0.362	0.354	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2243	1929	0.593	0.598	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	2318	1942	0.592	0.594	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	2320	1942	0.594	0.595	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	6.2	17.1	AAA domain
2	PF00063 Myosin_head	7.1e-266	895.4	Myosin head (motor domain)
3	PF02736 Myosin_N	1.3e-10	52.1	Myosin N-terminal SH3-like domain
4	PF01576 Myosin_tail_1	6.6e-110	380.3	Myosin tail
5	PF02367 TsaE	1.8e+02	13.5	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000463559	0.853	Myosin regulatory light chain 12B
2	9606.ENSP00000223167	0.829	Myosin regulatory light chain 10
3	9606.ENSP00000217652	0.824	Myosin regulatory light chain 12A
4	9606.ENSP00000383023	0.824	Myosin light chain 5
5	9606.ENSP00000450385	0.818	Myosin light chain 6B
6	9606.ENSP00000307280	0.816	Myosin light chain 1/3, skeletal muscle isoform
7	9606.ENSP00000325239	0.816	Myosin light chain, phosphorylatable, fast skeletal muscle
8	9606.ENSP00000446955	0.813	Myosin light polypeptide 6
9	9606.ENSP00000223364	0.810	Myosin regulatory light chain 2, atrial isoform
10	9606.ENSP00000279022	0.805	Myosin regulatory light polypeptide 9
11	9606.ENSP00000228841	0.803	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
12	9606.ENSP00000347055	0.803	Myosin light chain 4
13	9606.ENSP00000379210	0.803	Myosin light chain 3
14	9606.ENSP00000274364	0.789	Ras GTPase-activating-like protein IQGAP2
15	9606.ENSP00000359727	0.753	BAG family molecular chaperone regulator 2
16	9606.ENSP00000268876	0.743	Protein unc-45 homolog B
17	9606.ENSP00000420514	0.726	BAG family molecular chaperone regulator 1
18	9606.ENSP00000382323	0.706	Otogelin
19	9606.ENSP00000268182	0.698	Ras GTPase-activating-like protein IQGAP1
20	9606.ENSP00000467141	0.673	Titin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003774	0.995	cytoskeletal motor activity
GO:0000146	0.971	microfilament motor activity
GO:0008092	0.914	cytoskeletal protein binding
GO:0003779	0.875	actin binding
GO:0044877	0.712	protein-containing complex binding
GO:0051015	0.563	actin filament binding
GO:0003824	0.502	catalytic activity
GO:0097159	0.468	organic cyclic compound binding
GO:1901363	0.467	heterocyclic compound binding
GO:0019901	0.384	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0009987	0.978	cellular process
GO:0032502	0.945	developmental process
GO:0048856	0.934	anatomical structure development
GO:0061061	0.827	muscle structure development
GO:0065007	0.707	biological regulation
GO:0050789	0.688	regulation of biological process
GO:0009888	0.491	tissue development
GO:0048513	0.427	animal organ development
GO:0050794	0.422	regulation of cellular process
GO:0060537	0.332	muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.996	cytosol
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0099080	0.841	supramolecular complex
GO:0099512	0.827	supramolecular fiber
GO:0005856	0.614	cytoskeleton
GO:0032991	0.592	protein-containing complex
GO:0015629	0.532	actin cytoskeleton
GO:0005634	0.350	nucleus
GO:0071944	0.331	cell periphery
GO:0016020	0.323	membrane
GO:0043292	0.316	contractile fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.971	myosin ATPase.

[back to server]